PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678385698
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 288aa    MW: 32458.4 Da    PI: 7.2792
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678385698genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.55.5e-53141391128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrF Ptdeel+v+yL++kv+g++++l ++i e+d+yk++PwdLp k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk v+  +g++v
  678385698  14 LPPGFRFYPTDEELLVQYLCRKVSGHHFSL-QIIGEIDLYKFNPWDLPDKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVVTM-EGRKV 111
                79***************************9.89***************8777899************************************999.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy+g+apkg+kt+W+mheyrl
  678385698 112 GIKKALVFYTGKAPKGVKTNWIMHEYRL 139
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-659162IPR003441NAC domain
PROSITE profilePS5100560.14314162IPR003441NAC domain
PfamPF023653.1E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MVARESDPRS KLHLPPGFRF YPTDEELLVQ YLCRKVSGHH FSLQIIGEID LYKFNPWDLP  60
DKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVVTMEGRK VGIKKALVFY  120
TGKAPKGVKT NWIMHEYRLS DLARKHGSAR LDDWVLCRIY EKNSAARKQE TVSDFETALA  180
SPCKYDDGAD SLPQMGGNGP SDSFKNFYME EEKLQMNHLN HRFGFGSGSG SSYLDESSMG  240
ALVSEMAAEH QGGVGISGFP DDAWCDQRLG GLPHGYAGSY DALWGQYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-9811687174NAC domain-containing protein 19
3swm_B1e-9811687174NAC domain-containing protein 19
3swm_C1e-9811687174NAC domain-containing protein 19
3swm_D1e-9811687174NAC domain-containing protein 19
3swp_A1e-9811687174NAC domain-containing protein 19
3swp_B1e-9811687174NAC domain-containing protein 19
3swp_C1e-9811687174NAC domain-containing protein 19
3swp_D1e-9811687174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}.
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678385698
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
UniProtINDUCTION: Strongly induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by cold treatment. Not induced by jasmonic acid. {ECO:0000269|PubMed:15319476, ECO:0000269|Ref.7}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012842278.11e-112PREDICTED: NAC domain-containing protein 72-like
SwissprotA0A3Q7HH641e-102JA2L_SOLLC; NAC domain-containing protein JA2L
SwissprotQ93VY31e-103NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A022QZL01e-110A0A022QZL0_ERYGU; Uncharacterized protein
STRINGMigut.M00863.1.p1e-111(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-105NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Zhu X, et al.
    Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes.
    Plant J., 2015. 84(3): p. 597-610
    [PMID:26407000]
  3. Li S, et al.
    The role of ANAC072 in the regulation of chlorophyll degradation during age- and dark-induced leaf senescence.
    Plant Cell Rep., 2016. 35(8): p. 1729-41
    [PMID:27154758]
  4. Ye H, et al.
    RD26 mediates crosstalk between drought and brassinosteroid signalling pathways.
    Nat Commun, 2017. 8: p. 14573
    [PMID:28233777]
  5. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  6. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]