PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678378237
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TCP
Protein Properties Length: 217aa    MW: 24350.3 Da    PI: 8.5353
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678378237genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1021e-311492280
        TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaessss 80
                g+kdrhsk+ T +g+RdRRvRls+++a +++dLqd+LG+ ++sk +eWLl++ak ai+el+ ++ +  s++ ++ ++ 
  678378237 14 FGGKDRHSKVRTVRGLRDRRVRLSVQTAMQVYDLQDRLGVGQPSKVVEWLLNAAKDAIDELPPLQIPEGSSFFQGLEQP 92
               689*************************************************************666554442222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.3E-291694IPR005333Transcription factor, TCP
PROSITE profilePS5136930.711674IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MLKNPRVVRV SRAFGGKDRH SKVRTVRGLR DRRVRLSVQT AMQVYDLQDR LGVGQPSKVV  60
EWLLNAAKDA IDELPPLQIP EGSSFFQGLE QPSSHHLEFV DQALNWNPDA ERLDFSARID  120
AEKEIAASVF NPFGRWDPPR GHEFPYGHHQ DVHAIGAAQW ATAHVDQHGV PWHPSWKFDS  180
KSINLQDGSR IPNVFLDSSG DASSRPPSPS KVPTCLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A6e-182175155Putative transcription factor PCF6
5zkt_B6e-182175155Putative transcription factor PCF6
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678378237
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A1J6JFL23e-40A0A1J6JFL2_NICAT; Transcription factor tcp13
TrEMBLA0A251S7B77e-40A0A251S7B7_HELAN; Putative transcription factor, TCP
STRINGXP_009792504.12e-40(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.15e-28plastid transcription factor 1