PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678377576
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 236aa    MW: 26415.3 Da    PI: 4.1796
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678377576genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like51.71.9e-16113161151
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                k+r+ W++eLH +Fv+ave+  G+  +tPk+ile+m  + L + hv+SHLQ
  678377576 113 KERVSWNEELHGKFVKAVEKF-GIG-TTPKRILEFMADPRLKRRHVASHLQ 161
                68*******************.666.8************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.68E-9110161IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.7E-17111161IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-16113161IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MPCSSLTAAL ASLPDEIDQV VVLVSVDGEF KKIEKEAAPD NVPVLVVLCE RRALCFCYDI  60
PIPMPEVCSV MNQYVRDIEG APFNTPTGTS QRRSFESTNR EVESVDGSYK KKKERVSWNE  120
ELHGKFVKAV EKFGIGTTPK RILEFMADPR LKRRHVASHL QDAPPINPDE QPQSLDDQQQ  180
DAPPINPDER SQSLDDQQQD APPINLNEPS QCLDDQQQDA LSIDPDEPSQ SSDDEE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58080.14e-12response regulator 18