PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678372534
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CPP
Protein Properties Length: 630aa    MW: 68408.2 Da    PI: 6.6833
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678372534genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR505.7e-16349387341
        TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                +k+CnCkkskClk+YCeCfaag++C e C C dC Nk  
  678372534 349 CKRCNCKKSKCLKLYCECFAAGVYCMELCACVDCYNKPA 387
                89**********************************975 PP

2TCR51.91.5e-16433471139
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                ++k+gCnCkks ClkkYCeC+++g+ Cs +C+Ce+C+N 
  678372534 433 RHKRGCNCKKSGCLKKYCECYQSGVGCSFNCRCEGCRNA 471
                589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.8E-15347388IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.909348473IPR005172CRC domain
PfamPF036386.5E-12350385IPR005172CRC domain
SMARTSM011144.5E-17433474IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.6E-12435471IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MLLSGRHQLP EPSKPEFASD CGITATESQL TTDGSKSLAL EVHVQNLKPK ESAGKAPAGN  60
MVPCNSSRRV SCVLDSCQGI PYGTRGDSEG EDNADQTAEV TSSEWDCLIA DALKFESPNE  120
ENSYRTSVNP QSNTYMTVEH EMHVSTEQLG GGNGKDSLCT VLGEGMDIGD AHECITGSSA  180
SDPDNAMDCE HHFGIYRGMR RRCLVFEMGA AGRKHLKQNY GPESSSIQQP ETADFSNDQS  240
LVPMKDENQS LCHLLPGIGL HLNALASTPN NSKTGSHDSS ASRRLLIGPS SSVNFQSTIG  300
NQELHNDIPS AGTDRADLGQ ESAYIATEDM SHSSSKRKRS EPSAEAEGCK RCNCKKSKCL  360
KLYCECFAAG VYCMELCACV DCYNKPAHED TVLATRTQIE SRNPLAFAPK VIPGSDMLSE  420
TRDYSTKTPA SARHKRGCNC KKSGCLKKYC ECYQSGVGCS FNCRCEGCRN AFGRKNGYLV  480
GMEADVEDHG KDASDESFFH GTPHETLLEN NFDSDTPATP KRNKRQLIQL QCSSKKKPPR  540
ASVSTINIRN VLGGKSSFKL PPNSDQHLET VKEDDISNVM HEFSSPSCVV KSLSPNGKRV  600
SPPHSATGLR SSRKLILQSI PSFPSLTQNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-1835047012120Protein lin-54 homolog
5fd3_B4e-1835047012120Protein lin-54 homolog
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678372534
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090684.10.0LOW QUALITY PROTEIN: protein tesmin/TSO1-like CXC 2
TrEMBLA0A2G9GVD91e-180A0A2G9GVD9_9LAMI; Metallothionein-like protein
STRINGMigut.G00370.1.p1e-174(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24672345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-107Tesmin/TSO1-like CXC domain-containing protein