PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678371213
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 532aa    MW: 61166.4 Da    PI: 4.4626
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678371213genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like73.33.4e-23209262156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r+ Wt+eLH++Fv+ave L G++ +tPk+ile+m+v gL + hv+SHLQk+R +
  678371213 209 KKRISWTEELHSKFVKAVETL-GTD-TTPKKILEFMGVAGLERGHVASHLQKFRKH 262
                68*******************.666.8***************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.532206264IPR017930Myb domain
SuperFamilySSF466892.96E-15206265IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-23207266IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-21209262IPR006447Myb domain, plants
PfamPF002493.5E-8213259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MHVDRWHSRA DNQPNPRKVE LLCVFSYQES SLASGLLLLL PGLDNPTPPH PMNLLSAASY  60
QRIMEAFICL PRLQDCVLGV MMVTYILFLF LVSPSSSVTA ALASLPDIID EVVVFVYSDG  120
KFKQIERESA PDNISCFSLS GVRFVSAIAI PLPMSEVCNM VNQHGIKEEN NTRDIQATPS  180
TSPTGTSQRR SFEGRNTKVE SLDGSCKKKK RISWTEELHS KFVKAVETLG TDTTPKKILE  240
FMGVAGLERG HVASHLQKFR KHLKQMENTN ASRLLDDQQQ NAPPITYPDE PLQYLYDQQR  300
NAPPITTYPD EPLQYLYDQQ LNAPPITYPD EPLQYFYDQQ LNAPPIIHPD EPQQYLYDQQ  360
QIAPSITHPD EPLQYLYGQQ QNGTLITHPD EPLQYLYDQQ QNVPPINPEE PLQYLYDQQQ  420
NATPINSDEP PQYFYDQQQN ATPINQDEPP QYLYDQQQNA TPINSDEPPQ YFYDQQQNAT  480
PINQDEPPQY LYDQQQNATP INPDEAFEYL YYREQMLLQS VIRMNRRKTS FH
Cis-element ? help Back to Top
SourceLink
PlantRegMap678371213
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58080.11e-16response regulator 18