PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678370821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 306aa    MW: 34346.4 Da    PI: 9.1188
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678370821genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.65.1e-2759112256
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 +++WtpeLH++Fv+ave+L G ekA+P++ilelm++++Lt+++v+SHLQkYR++
  678370821  59 IKVDWTPELHKQFVQAVEEL-GLEKAVPSRILELMGINCLTRHNVASHLQKYRTH 112
                5899****************.********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.29155114IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2556115IPR009057Homeodomain-like
SuperFamilySSF466893.94E-1757115IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-2558113IPR006447Myb domain, plants
PfamPF002491.9E-861110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MESDSEEMQT HENEASGSSE KSFAETASGS KTKMEAAVVD PEVGRGGQST KNPPGKRKIK  60
VDWTPELHKQ FVQAVEELGL EKAVPSRILE LMGINCLTRH NVASHLQKYR THKRRLLARE  120
AQLASSKQRH LIHGAADASD CNVPTMGFPP PNLTPCCVWG HPSTDQPFAH MWRWPQPPQA  180
PLFMDPYFWY YSHHHGRYVS VFQIVAFMKK QCHLDMRFFF IQNYSTTLPV PGVPQTDIYR  240
VSPLHGLPKL PAQPSFPIPP VSHLSVSSVF SSCVCAGLCW RGPRKGHESF CSVLLRQGKP  300
SRVVVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-1655116263ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100407.12e-59PREDICTED: probable transcription factor GLK1
STRINGPOPTR_0017s04720.17e-47(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.11e-42GBF's pro-rich region-interacting factor 1