PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678365529
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 357aa    MW: 40250.1 Da    PI: 8.6001
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678365529genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.11.8e-49511762128
        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvg 101
                +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rdkky++g+r+nr+tksgyWkatg d+ + s++ + +g
  678365529  51 MPGFRFHPTEEELIEFYLRRKVEGRRFNI-ELIAFLDLYRHDPWELPALAAIGEKEWYFYVPRDKKYRNGDRPNRVTKSGYWKATGADRMIRSETFRSIG 149
                79***************************.89***************8778899****************************************99**** PP

        NAM 102 lkktLvfykgrapkgektdWvmheyrl 128
                +kktLvfy+g+apkg +t W+m+eyrl
  678365529 150 IKKTLVFYSGKAPKGIRTGWTMNEYRL 176
                *************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100554.77750197IPR003441NAC domain
SuperFamilySSF1019411.44E-5550196IPR003441NAC domain
PfamPF023654.7E-2552176IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MAVGATRLMS THREEESTSK SNDQDHPSQA AAAAAAAAPP PVDEHEQDAV MPGFRFHPTE  60
EELIEFYLRR KVEGRRFNIE LIAFLDLYRH DPWELPALAA IGEKEWYFYV PRDKKYRNGD  120
RPNRVTKSGY WKATGADRMI RSETFRSIGI KKTLVFYSGK APKGIRTGWT MNEYRLPIHE  180
TERLQKAEIS LCRVYKRAGI KDHPSLPRST PRSKGSQPVK VQTPPPANQE AVSRSIQHDE  240
ETMLFLQFKH PSASSSPQHC SSIYANSPPN NVDDLHKLVN GAGYRHQDSS SISDSHENTP  300
FPTPVTPISL ISYIPSSQPQ TTAMVAATNT PDSAQVVFPW DWSAIHEGSK DFTTFFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-544319710165NO APICAL MERISTEM PROTEIN
1ut4_B2e-544319710165NO APICAL MERISTEM PROTEIN
1ut7_A2e-544319710165NO APICAL MERISTEM PROTEIN
1ut7_B2e-544319710165NO APICAL MERISTEM PROTEIN
3swm_A2e-544319713168NAC domain-containing protein 19
3swm_B2e-544319713168NAC domain-containing protein 19
3swm_C2e-544319713168NAC domain-containing protein 19
3swm_D2e-544319713168NAC domain-containing protein 19
3swp_A2e-544319713168NAC domain-containing protein 19
3swp_B2e-544319713168NAC domain-containing protein 19
3swp_C2e-544319713168NAC domain-containing protein 19
3swp_D2e-544319713168NAC domain-containing protein 19
4dul_A2e-544319710165NAC domain-containing protein 19
4dul_B2e-544319710165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011092242.11e-120PREDICTED: putative NAC domain-containing protein 94
TrEMBLA0A068TNX51e-120A0A068TNX5_COFCA; Uncharacterized protein
STRINGGLYMA17G00650.21e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38882446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-105NAC domain containing protein 35