PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678364718
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 294aa    MW: 32663.4 Da    PI: 5.9485
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678364718genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.54.8e-31158213156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+ eLHerF++a+e+LGGs++AtPk+i+elm+++gLt+++vkSHLQkYRl+
  678364718 158 KARRCWSLELHERFLHALEKLGGSQRATPKQIRELMQMDGLTNDEVKSHLQKYRLH 213
                68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.519155215IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-27156216IPR009057Homeodomain-like
SuperFamilySSF466891.85E-16156216IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-25158213IPR006447Myb domain, plants
PfamPF002497.7E-8160211IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MNEEYIEALE EERRKIRVFQ RELPLCLELV TQTIESWKQG LVGSEKSGSE EPDLEEFIPV  60
KGVSDCAQQG IFEEDEDGNS RKSDWLRSVQ LWSQNPDPVS NSKLSSPRRV AVIEVQRNGC  120
AFHPFTDSTP MKSAPPSSSS TVETSGARKK QDKESQRKAR RCWSLELHER FLHALEKLGG  180
SQRATPKQIR ELMQMDGLTN DEVKSHLQKY RLHARRPGSS PNPATPAMTE ATPQFVVVGG  240
IWVPSAMGTT ASEGEVSSPE IYAPVAKHPN PFQEPESDSK GTSERAPAHG NASV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070832.12e-93PREDICTED: uncharacterized protein LOC105156412
TrEMBLD7T9875e-90D7T987_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03110.t012e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.16e-72G2-like family protein