PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678364418
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family Whirly
Protein Properties Length: 232aa    MW: 25347.9 Da    PI: 9.8387
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678364418genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly187.62.1e-58561912137
     Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpd 101
                vyk+kaal  + ++p+f+ l+sg+ +l+r+Gg++l+l +a++erky+Wek+q f+lsatev++l++l+skesceffhdpa+k+sn+G++rk+l+++ + d
  678364418  56 VYKGKAALAAEMILPKFNRLKSGSYRLERSGGVMLTLWPAIGERKYNWEKRQLFSLSATEVGSLISLGSKESCEFFHDPAMKSSNAGQIRKTLSIKAHDD 155
                9*************************************************************************************************** PP

     Whirly 102 GsGlfvnlsvtnslvkgnesfsvPvskaefavlrsl 137
                GsG+f+ l v n+++++n++++vPvs aefavlrs+
  678364418 156 GSGYFITLGVMNNVLRTNDRLTVPVSTAEFAVLRSA 191
                *********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.106.3E-6947215IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544476.83E-6249232IPR009044ssDNA-binding transcriptional regulator
PfamPF085364.9E-5656191IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MFVEASSDLT LLRGMSFKAG VSAAFPGSTE ATIPTAYSRV RPDGNPGIKI YAPYTVYKGK  60
AALAAEMILP KFNRLKSGSY RLERSGGVML TLWPAIGERK YNWEKRQLFS LSATEVGSLI  120
SLGSKESCEF FHDPAMKSSN AGQIRKTLSI KAHDDGSGYF ITLGVMNNVL RTNDRLTVPV  180
STAEFAVLRS ACTFALPHLL GWDKHSNQLP SSNSESSYRS AAPAIPSLEW DR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A8e-834920810169StWhy2
3n1i_A8e-834920810169protein StWhy2
3n1j_A8e-834920810169Protein StWhy2
3n1k_A8e-834920810169protein StWhy2
3n1l_A8e-834920810169protein StWhy2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095185.11e-101PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial
SwissprotD9J0342e-86WHY2_SOLTU; Single-stranded DNA-bindig protein WHY2, mitochondrial
TrEMBLA0A022Q8354e-99A0A022Q835_ERYGU; Uncharacterized protein
STRINGSolyc11g044750.1.13e-85(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97822228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.13e-77WHIRLY 2