PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678362024
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 248aa    MW: 26926.1 Da    PI: 5.9738
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678362024genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.41.4e-274696151
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
               kprlrWtpeLH+ F++av+qLGG+ kAtPktil+lm+v+g++l+h+kSHLQ
  678362024 46 KPRLRWTPELHHLFLKAVHQLGGPSKATPKTILNLMNVEGISLHHLKSHLQ 96
               79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-244496IPR009057Homeodomain-like
SuperFamilySSF466891.79E-134597IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-214696IPR006447Myb domain, plants
PfamPF002494.4E-84896IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MPSKSRTGGG GGCGRNPNPT IPNRRRFHVP DVEIDDEEEP PEADQKPRLR WTPELHHLFL  60
KAVHQLGGPS KATPKTILNL MNVEGISLHH LKSHLQLNSL VATDAAFPIK VPQLTHQGQG  120
CSFSSSSDGT GFWYEYMANA FAAETYGHLD SQGAMVNAEM ASSSNTEVGS RVPSLGVEVD  180
SYLPNWCDVL GGVRRQQPVL PMSFDNELMD DYLNSLSLHP RQFEPPLGGD VAAGNSDPAA  240
VSFVGVKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA120621623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.21e-20G2-like family protein