PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678361766
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 236aa    MW: 27509 Da    PI: 6.7822
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678361766genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1752.1e-5461331128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPtdeelv++yL++k++g  +el ++i+evd+yk+ePwdL  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v s +++
  678361766   6 LPPGFRFHPTDEELVNYYLRRKIHGLGIEL-DIIPEVDLYKCEPWDLAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVSS-QNR 103
                79****************************.99**************84335556888*************************************9.899 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 +g+kktLv+y+grap+g++tdWvmheyrl
  678361766 104 SIGMKKTLVYYRGRAPHGVRTDWVMHEYRL 133
                9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-644157IPR003441NAC domain
PROSITE profilePS5100559.8016156IPR003441NAC domain
PfamPF023655.8E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLRRKIHG LGIELDIIPE VDLYKCEPWD LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVSS QNRSIGMKKT LVYYRGRAPH  120
GVRTDWVMHE YRLNDKDSEE TSVIQDSCVL CRVFKKNVLS SKVEEQGHSR NMSFLNYLQG  180
PVYSNTHETL LLDFPVASST TVCSMEEEGN KDESWMQFIT DDVWCGEQVS QLNFIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-56215711169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678361766
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072043.21e-133NAC domain-containing protein 86 isoform X2
SwissprotQ9FFI51e-85NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A068TRH51e-129A0A068TRH5_COFCA; Uncharacterized protein
STRINGMigut.O00243.1.p1e-127(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-116NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]