PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678361727
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 264aa    MW: 29000.8 Da    PI: 7.0832
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678361727genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.37.1e-41147224178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cq +gC+adls+ak+yhrrhkvCe+hska++v++ gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+q 
  678361727 147 RCQTDGCNADLSHAKHYHRRHKVCEFHSKAATVVAGGLTQRFCQQCSRFHVLSEFDNGKRSCRKRLADHNRRRRKSQR 224
                6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.4E-34141209IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.966145222IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.37E-38146224IPR004333Transcription factor, SBP-box
PfamPF031103.8E-31148221IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MLDYGWVSGA ETGQESDNLP VYDPYGLQNY SQAATYVNPE AQFGAGAGGP NAVPFHGHPD  60
ANLQGFYDAG GVQPYHNPSM LSLEPSFPMA YMVMPKAEPA GSGFEFSSSL GLNLGGRTYF  120
ASAEDDFVTR LYRGSRILDS GTANVQRCQT DGCNADLSHA KHYHRRHKVC EFHSKAATVV  180
AGGLTQRFCQ QCSRFHVLSE FDNGKRSCRK RLADHNRRRR KSQRANEATS SKSQIENPSD  240
ANSPSENMSS SDSDFHIPCK TQQD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-32140221384squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678361727
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090046.11e-99squamosa promoter-binding-like protein 8
SwissprotQ8GXL32e-64SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A2G9HWN01e-103A0A2G9HWN0_9LAMI; Uncharacterized protein
STRINGMigut.B01572.1.p7e-89(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48462341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-59squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xing S, et al.
    SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility.
    Plants (Basel), 2013. 2(3): p. 416-28
    [PMID:27137384]