PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678358070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 239aa    MW: 28080.4 Da    PI: 4.6566
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678358070genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.76.4e-5561331128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPtdeelv++yLk+k++g ++el ++i+evd+yk+ePwdL  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v+s +++
  678358070   6 LPPGFRFHPTDEELVNYYLKRKIHGLEIEL-DIIPEVDLYKCEPWDLAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVTS-QNR 103
                79****************************.99**************84335556888**************************************.889 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kktLv+y+grap+g +tdWvmheyrl
  678358070 104 SVGMKKTLVYYRGRAPQGIRTDWVMHEYRL 133
                9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-634157IPR003441NAC domain
PROSITE profilePS5100560.2876156IPR003441NAC domain
PfamPF023655.3E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKIHG LEIELDIIPE VDLYKCEPWD LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVTS QNRSVGMKKT LVYYRGRAPQ  120
GIRTDWVMHE YRLDDKDMEE ASGIQDSYAL CRVFKKNVLI SEVEEQGLSR DLSFLDYMQG  180
PMYPTEHETQ SPDFPLASSS TICNIEEEDR DENKDESWMQ FITDDVWCGE EVSQLNFIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-55215711169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072043.11e-143PREDICTED: NAC domain-containing protein 86
SwissprotA4VCM04e-89NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A068TRH51e-137A0A068TRH5_COFCA; Uncharacterized protein
STRINGGSMUA_Achr3P13880_0011e-132(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-120NAC domain containing protein 57