PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678357610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 456aa    MW: 50048.3 Da    PI: 10.7122
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678357610genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.4e-32214267255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  678357610 214 PRMRWTNSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 267
                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-15211267IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28212267IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-24214267IPR006447Myb domain, plants
PfamPF002495.4E-7215266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MSRDGVFLEL SSSQMPDLSL QISLSNTAAS PKNRQQVQSF DRSVAGIPST DVDAAALATE  60
LSLRTNFEAP KSFNGGNQPD PQNPSRNYTL QTSSTQPIKG IPIYPSTNRP FPFSPLEQKD  120
PKTRFFQMPS WPSIPIPRPY FAGSATLDHH LPMPNLAPSG AGFLYRAGAG GFHQMHPHGQ  180
HPQFGIEGGG GSHHGLHRSR FLPRMQSKRS MRAPRMRWTN SLHARFVHAV ELLGGHERAT  240
PKSVLELMDV KDLTLAHVKS HLQMYRTVKT TDKPAVSSGH SEGSGGEDEI SVVCGDRPTG  300
VRSFTDQRDP QQDSDTNPRL WSNSSSSREG WLQMNAGEAQ SLVGTTNFSA ASDHLVSSCK  360
KHPRHTQSPG ICSLCLCEKL TQLTTASSKG GKSIRVFVNR SHRILEKSRS MAFGSGRRGD  420
DAKSDDTKNG FLSKLVLRRN KRPLMHSRSI RATGIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085885.15e-85PREDICTED: transcription repressor KAN1
STRINGVIT_04s0043g00340.t013e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.17e-49G2-like family protein