PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678357201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 253aa    MW: 28834.5 Da    PI: 7.0086
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678357201genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.33.7e-50101381129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgel 99 
                lppGfrF P+deelv++yL kk+++++l    ++ e+d++ +ePw Lp  +k +++ewyfFs rd+kyatg r+nrat++gyWkatgkd++v++k  + +
  678357201  10 LPPGFRFYPSDEELVCHYLYKKTRNEELVR-GTLVEIDLHVCEPWMLPDVAKLNSNEWYFFSFRDRKYATGYRTNRATTTGYWKATGKDRPVVDKrVSGV 108
                79*************************888.78***************87778899*************************************9865678 PP

        NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                vg++ktLvfy++rapkg+kt W+mhe+rle
  678357201 109 VGMRKTLVFYRNRAPKGVKTGWIMHEFRLE 138
                ***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-608156IPR003441NAC domain
PROSITE profilePS5100557.24410156IPR003441NAC domain
PfamPF023651.6E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MGLRDIGQTL PPGFRFYPSD EELVCHYLYK KTRNEELVRG TLVEIDLHVC EPWMLPDVAK  60
LNSNEWYFFS FRDRKYATGY RTNRATTTGY WKATGKDRPV VDKRVSGVVG MRKTLVFYRN  120
RAPKGVKTGW IMHEFRLENP HLPPKEDWVL CRVFHKSRSS PAEYTSKYLN DHQPQGASSS  180
HLDMGASVLS TGLNHGHDIP PLSSPNTGYT VSKIMADAKC EDEYGFLLDF FTPDGLGMDD  240
ASNFEDDGSS VFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-48916016169NO APICAL MERISTEM PROTEIN
1ut4_B8e-48916016169NO APICAL MERISTEM PROTEIN
1ut7_A8e-48916016169NO APICAL MERISTEM PROTEIN
1ut7_B8e-48916016169NO APICAL MERISTEM PROTEIN
3swm_A9e-48916019172NAC domain-containing protein 19
3swm_B9e-48916019172NAC domain-containing protein 19
3swm_C9e-48916019172NAC domain-containing protein 19
3swm_D9e-48916019172NAC domain-containing protein 19
3swp_A9e-48916019172NAC domain-containing protein 19
3swp_B9e-48916019172NAC domain-containing protein 19
3swp_C9e-48916019172NAC domain-containing protein 19
3swp_D9e-48916019172NAC domain-containing protein 19
4dul_A8e-48916016169NAC domain-containing protein 19
4dul_B8e-48916016169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007050267.11e-106NAC domain protein, IPR003441
SwissprotQ84TE69e-62NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A061DNM91e-106A0A061DNM9_THECC; NAC domain protein, IPR003441
STRINGGLYMA19G34881.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-89NAC domain containing protein 74