PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678357032
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family WRKY
Protein Properties Length: 512aa    MW: 56145.1 Da    PI: 5.8639
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678357032genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.71.5e-30215273160
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                ldDgynWrKYGqK+vkg e+prsYY+Ct+++Cp+kkkve++  d+ + ei+Y+g+H h+k
  678357032 215 LDDGYNWRKYGQKQVKGRENPRSYYKCTYPNCPTKKKVETCV-DGPIAEIIYKGTHSHPK 273
                59****************************************.***************85 PP

2WRKY102.91.8e-32382440159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDg++WrKYGqK+vkg+++prsYY+Ct +gCpv+ +vers++d ++v++tYeg+Hnhe
  678357032 382 LDDGFRWRKYGQKVVKGNPNPRSYYKCTANGCPVREHVERSSHDHRAVITTYEGRHNHE 440
                59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.136210274IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.2E-26211274IPR003657WRKY domain
SuperFamilySSF1182909.29E-24214274IPR003657WRKY domain
SMARTSM007741.6E-32215273IPR003657WRKY domain
PfamPF031062.9E-23216272IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.0E-35367442IPR003657WRKY domain
SuperFamilySSF1182902.35E-28374442IPR003657WRKY domain
PROSITE profilePS5081136.919377442IPR003657WRKY domain
SMARTSM007747.2E-37382441IPR003657WRKY domain
PfamPF031061.6E-24383440IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MAAAAAAGVD FSAVISHPNS SESTTPMSDN RSASGVPKFR SLPPPSLPIS PSSSSSWFTI  60
PPGLSPSELL DSPILLSGSN VLPSPTTGSF PVGSLDGKSS FDWLRQEELK QQQSDDTQDE  120
SNTNSFSDFT FPAQNNQQLP TATDYGSTTL WGYDQTQAAS NNNRVEEESS DQKQDFNSSS  180
DQGFSPDIAS IQANHDGIHG EYNNNNSSGA SKRKLDDGYN WRKYGQKQVK GRENPRSYYK  240
CTYPNCPTKK KVETCVDGPI AEIIYKGTHS HPKPHSTRRS STSSCYSHLA DISDTKAFSS  300
TRIPKMDSWS SVITSDNTST LPGDDFEQSH SGKDDLDDEE PDPKRWKNEV ETDRNSSVSG  360
GSSRAVREPR VVVQTTSDID VLDDGFRWRK YGQKVVKGNP NPRSYYKCTA NGCPVREHVE  420
RSSHDHRAVI TTYEGRHNHE VPATRGSGVA GSHSVTRPLP YNPYNATLGM GNGALMLFPD  480
NSKVQATYTL DHIQSVPKTE PGDDDFMNFL LC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-33215443878Probable WRKY transcription factor 4
2lex_A1e-33215443878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014489595.11e-139PREDICTED: probable WRKY transcription factor 26
TrEMBLA0A0D5YAC01e-142A0A0D5YAC0_SALMI; WRKY protein
STRINGGLYMA14G38010.11e-135(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22862460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.13e-85WRKY DNA-binding protein 33