PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678354354
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 344aa    MW: 38538.2 Da    PI: 7.4816
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678354354genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like728.7e-2373124154
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                k+r +W pe H+ F+eav++L Gs +A P +il+lmk++gLt++hv+SHLQkYR
  678354354  73 KQRFVWHPEYHQMFLEAVQRL-GS-NASPMRILKLMKIEGLTRDHVASHLQKYR 124
                79*******************.54.6**************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-2270129IPR009057Homeodomain-like
PROSITE profilePS512949.95670128IPR017930Myb domain
SuperFamilySSF466892.07E-1572129IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-2173126IPR006447Myb domain, plants
PfamPF002499.7E-678124IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MCRPTRTYVS GYMQSRNAMM LVEHTVTRNT ANPSQGNGNG NGSQPTNDTG RPGFDKGEQS  60
RSAKTRVDKK DKKQRFVWHP EYHQMFLEAV QRLGSNASPM RILKLMKIEG LTRDHVASHL  120
QKYRDQLKKQ QVSDKNTCPQ RETPNVSTNC PHASVNLNPT NLTFPTNSHH VVQDYFYNFS  180
SGTWPIYHAN PTPCICSSPP LWPAPITCFP DDHFSAGCNV PIKHEDSHVP HSHSLGFINS  240
HPPNPLSGSH LPVRDVVGNG VNPRGQTMQA MFEHHNLGRE YALAPLPLEQ GIQPMPQLTP  300
SQSDDLLSNL DESQLVAMYL QIEQLQRFQE TDLPPEQAPN GDAI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58080.11e-15response regulator 18