PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678353162
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CPP
Protein Properties Length: 650aa    MW: 71779.3 Da    PI: 5.5482
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678353162genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.71.8e-16468506341
        TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                +k+CnCkkskClk+YCeCfaag++C e C C dC+Nk  
  678353162 468 CKRCNCKKSKCLKLYCECFAAGVYCMELCACVDCHNKPA 506
                79**********************************975 PP

2TCR51.32.4e-16552590139
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                ++k+gCnCkks ClkkYCeC+++g+ Cs +C+Ce+CkN 
  678353162 552 RHKHGCNCKKSGCLKKYCECYQSGVGCSFNCRCEGCKNA 590
                5899**********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-16466507IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.504467592IPR005172CRC domain
PfamPF036382.0E-12469504IPR005172CRC domain
SMARTSM011147.1E-16552593IPR033467Tesmin/TSO1-like CXC domain
PfamPF036388.6E-12555590IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MREDGIENCA RKRDKEDLEP EIPNRNNNKK TAAAVWKIED SPIFKFINNL SPLKPVECTR  60
VSQTINTLYL ASIPSVFNSP QMNSQRDTRI LQGHQLPDPS KPEFTSDFGI MLQESQVNTD  120
CSEPLEAKVE DLKAKDSAAE VAGELSFDCL KFVLDPSEDP SYNDTSPSSC SVLKDGKLEN  180
FPFSSPRLVS CVPDSCQEVQ YGSEMDFEWK KRADQNAEVA PSEFDCLISD ALKFESPNDE  240
HSYKTLMNTE SNIHMTVGNG IQRTCLAVST EQLGEGTEHD PLSSQPGEGR DFCDAPELIT  300
GSPARDTAEE PDCEHHFGLC RGMRRRCLVF EMGTVGRKNL EQNYGPESSL ILQPENSAFS  360
KDQSLVPMKA ENKSSCHLLS GIGLHLNALA STRNFSRIGS CDSSASRRLL IGTSYSVNFH  420
SSIRNQEHHG DVYRADPFQE SAYVATEDMN QSSSKKKRAE SSEDADGCKR CNCKKSKCLK  480
LYCECFAAGV YCMELCACVD CHNKPAHEGT VLSTRKQIES RNPLAFAPKV IQGSDILSET  540
GDYYSKTPAS ARHKHGCNCK KSGCLKKYCE CYQSGVGCSF NCRCEGCKNA FGRKNGSLVS  600
TEAEAEVGEM DASDKVDTPK HTIVPFTHSK PVKPLLQLQD SLLKQSSGES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1846958912120Protein lin-54 homolog
5fd3_B1e-1846958912120Protein lin-54 homolog
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678353162
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090684.10.0LOW QUALITY PROTEIN: protein tesmin/TSO1-like CXC 2
TrEMBLA0A2G9GVD90.0A0A2G9GVD9_9LAMI; Metallothionein-like protein
STRINGMigut.G00370.1.p1e-164(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24672345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.14e-97Tesmin/TSO1-like CXC domain-containing protein