PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678349310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family bZIP
Protein Properties Length: 428aa    MW: 47880.9 Da    PI: 8.3039
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678349310genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.66.5e-09109141739
                HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLe 39 
                 rr+++NReAAr+sR+R+ka++++Le+    L+
  678349310 109 LRRLAQNREAARKSRLRRKAYVQQLETSRMRLT 141
                699***********************8655554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0039103165IPR004827Basic-leucine zipper domain
PfamPF077164.1E-5106148IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.04E-5109149No hitNo description
Gene3DG3DSA:1.20.5.1704.6E-6110150No hitNo description
PROSITE patternPS000360110125IPR004827Basic-leucine zipper domain
PfamPF141441.7E-28222295IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MGELDQAIFQ FFEGQDRGAA NQDQPQSSSG LRPPTLNIFP SQPMHVDPFP APSKVNEGLA  60
VSPSTSASKK SSEQAMDHLS MNDASSPLEH SKRPYVCQSL KLKNMKQTLR RLAQNREAAR  120
KSRLRRKAYV QQLETSRMRL TQLEQEIQKA RAQEEIRPFL LPWRASTQVE DGLNLLFIAD  180
IILQRVLVIL MVYRSLSLRF RTAALFDVEY ARWLEDHHQI VSDLRNAVAD HLPENELHVL  240
VDNCLSHYDQ VTSLKGMIAK FDVFHLLSGT WRTPAERCFM WVGGFRPSEL IKIIVREVEP  300
LTEQQLMGIC GLQQSTHEAE EALSEDGPRH QQSLNPGSLH QTGSVSPRNL LLFIYTVACF  360
SAMNSVAGRK PKAPNPTPAT PNPECPAGGA LPHRHLGVLP TPPCPQLALV GPAYTRLSTV  420
IVIPSFLN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308062.21e-113hypothetical protein POPTR_0006s05770g, partial
SwissprotP239232e-73HBP1B_WHEAT; Transcription factor HBP-1b(c38)
TrEMBLA0A022RLS31e-114A0A022RLS3_ERYGU; Uncharacterized protein (Fragment)
TrEMBLA0A151TUB51e-114A0A151TUB5_CAJCA; Transcription factor HBP-1b(C1)
TrEMBLB9HA881e-113B9HA88_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0006s05770.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22792145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06839.24e-90bZIP family protein