PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678342908
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 547aa    MW: 61065.9 Da    PI: 8.015
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678342908genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-093934301954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+++++  L++++gL+++qV++WF N R +
  678342908 393 FEHflHPYPTEADKHLLSRQTGLSKNQVSNWFINARVR 430
                664459******************************88 PP

2BELL81.41.2e-262663231471
       BELL  14 slleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                 l ++V++rY +y+eq+q++++ F++v+g g+a+pYt+lA+ka+SrhFrc+kdai++ 
  678342908 266 VLSDKVEERYMRYCEQMQALVNWFDCVVGRGAAAPYTELAQKAMSRHFRCMKDAISNE 323
                5789***************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-34155322IPR006563POX domain
PfamPF075264.3E-39161321IPR006563POX domain
PROSITE profilePS5007112.357371434IPR001356Homeobox domain
SMARTSM003895.8E-9374438IPR001356Homeobox domain
CDDcd000862.82E-11374435No hitNo description
SuperFamilySSF466893.94E-17375442IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28377440IPR009057Homeodomain-like
PfamPF059207.0E-18391430IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MNKQVEWMVK EQELDLPTWG FGDAAAAAEF VAPPQSMVVG DHQIQSSFIW SQKQQLSAAV  60
NGAAVELVQT SADPQLQGHH LNGGPYSPSS IAGASQFGWI SGEDGLRAGR IMETQGLSLS  120
LSSSLRSIEA NKLHRINVGH NELYHRSHGL GVSNYAFTSF LRSSRYLRPA QELLLEICSV  180
GRVQFKRSKF DSHDKNPNQP SGAPASSTPP PLKDRHSLWP SERTEYQRRK IKLLSMFDEL  240
SIFTFSSQTA TRSIVVTAKE SQKNAVLSDK VEERYMRYCE QMQALVNWFD CVVGRGAAAP  300
YTELAQKAMS RHFRCMKDAI SNELKSACLL LGEKDVAGSR GLTKGETPRL KMLEQRYRQQ  360
KSIQQMGVLD PESWRPQRGL PERSVNILRS WLFEHFLHPY PTEADKHLLS RQTGLSKNQV  420
SNWFINARVR LWKPMVEEMY QRELQEVHHE AAAGDIHEAT APNPPTHSSN INGTESDPTA  480
VIDIGHQEPP PSFGEIPAFF APAGQIGGGG GITRAAGEVS LTLELRHKEN LPNVTMRQLT  540
SRDFEAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16380438563Homeobox protein Meis2
3k2a_B4e-16380438563Homeobox protein Meis2
4xrm_A5e-16380438563Homeobox protein Meis2
4xrm_B5e-16380438563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074481.11e-142PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-109BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLK4BV621e-125K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.11e-124(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-108BEL1-like homeodomain 4