PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678342664
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MIKC_MADS
Protein Properties Length: 341aa    MW: 39008.2 Da    PI: 7.2354
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678342664genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.62.6e-312675150
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
               krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  678342664 26 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 75
               79***********************************************8 PP

2K-box107.91.1e-351912874100
      K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                s++ s +ea+a+++qqe++kL+++i+nLq+ +R++lGe+L+ L+l+eL++Le+++e++++kiRskKnell+++ie++qk+e el+++n+ Lr+k++e
  678342664 191 SNQGSISEANAQYYQQEASKLRANISNLQNHNRNMLGESLGGLKLNELKNLETKVERGISKIRSKKNELLFAEIEYMQKREMELHHNNQFLRAKIAE 287
                3333499***************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.7861878IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-401877IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.12E-292086IPR002100Transcription factor, MADS-box
CDDcd002651.13E-382081No hitNo description
PROSITE patternPS0035002074IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-332040IPR002100Transcription factor, MADS-box
PfamPF003191.5E-262774IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-334055IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-335576IPR002100Transcription factor, MADS-box
PfamPF014866.1E-26199285IPR002487Transcription factor, K-box
PROSITE profilePS5129714.471201291IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MELQSDITGE EVSSERKVSR GKIEIKRIEN TTNRQVTFCK RRNGLLKKAY ELSVLCDAEV  60
ALIVFSSRGR LYEYANHRMK GPGEFCSDHP VAFTAVENVV DEIKVSEMQL SESEFESDSS  120
SSSSSSSPLC VTSWKIMSQN IIWLSKGLIF QSLLVYGFYL YLTVIHMPLP LFNCCSVKET  180
IERYKKATDS SNQGSISEAN AQYYQQEASK LRANISNLQN HNRNMLGESL GGLKLNELKN  240
LETKVERGIS KIRSKKNELL FAEIEYMQKR EMELHHNNQF LRAKIAETER VHQHMNLMPG  300
SCPGFELVHP QPYDTTEYLQ NTLQQNNESY PRQQAPSLQL V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-181879162Myocyte-specific enhancer factor 2B
1tqe_Q3e-181879162Myocyte-specific enhancer factor 2B
1tqe_R3e-181879162Myocyte-specific enhancer factor 2B
1tqe_S3e-181879162Myocyte-specific enhancer factor 2B
6c9l_A3e-181879162Myocyte-specific enhancer factor 2B
6c9l_B3e-181879162Myocyte-specific enhancer factor 2B
6c9l_C3e-181879162Myocyte-specific enhancer factor 2B
6c9l_D3e-181879162Myocyte-specific enhancer factor 2B
6c9l_E3e-181879162Myocyte-specific enhancer factor 2B
6c9l_F3e-181879162Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678342664
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022852034.18e-81floral homeotic protein AGAMOUS-like isoform X4
RefseqXP_022852042.13e-81floral homeotic protein AGAMOUS-like isoform X7
SwissprotQ401682e-74AG_SOLLC; Floral homeotic protein AGAMOUS
TrEMBLM8BNZ02e-84M8BNZ0_AEGTA; MADS-box transcription factor 3
STRINGEMT235384e-85(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-46MIKC_MADS family protein
Publications ? help Back to Top
  1. Pan IL,McQuinn R,Giovannoni JJ,Irish VF
    Functional diversification of AGAMOUS lineage genes in regulating tomato flower and fruit development.
    J. Exp. Bot., 2010. 61(6): p. 1795-806
    [PMID:20335407]
  2. Gimenez E, et al.
    TOMATO AGAMOUS1 and ARLEQUIN/TOMATO AGAMOUS-LIKE1 MADS-box genes have redundant and divergent functions required for tomato reproductive development.
    Plant Mol. Biol., 2016. 91(4-5): p. 513-31
    [PMID:27125648]