PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678339240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 173aa    MW: 19381 Da    PI: 10.5944
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678339240genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like44.53.3e-141021322555
    G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 +AtPk+i+elmk +gL+ +++kSHLQkYRl
  678339240 102 TVATPKRIKELMKEDGLSSDEIKSHLQKYRL 132
                57****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-5102135IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-12103133IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.8E-11103135IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MSGGNERTRR RISKDYVQGL EKERCKIQMF QRELPLSFEL VTKDFAAHRS SSGTRRYVAG  60
DRGRKKEAAD GREDTEEDKE KLVAGAAPKI LTRTGTPRRI ATVATPKRIK ELMKEDGLSS  120
DEIKSHLQKY RLQATKRPSV ATAQPPQQVA PDGIWVPPEF TSKATTTAPE SNK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-18G2-like family protein