PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678339175
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 403aa    MW: 44567.8 Da    PI: 7.5295
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678339175genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.71e-40156233178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +CqvegC+ dl++ak+yhrrh++Ce hsk+p+v+vsgle+rfCqqCsrfhelsefD++krsCrrrL++hn+rrr+ q+
  678339175 156 CCQVEGCNLDLKSAKDYHRRHRICENHSKSPKVIVSGLERRFCQQCSRFHELSEFDDKKRSCRRRLSDHNARRRRVQP 233
                6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-34151218IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.522154231IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.49E-38155236IPR004333Transcription factor, SBP-box
PfamPF031102.4E-32157230IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MERKSMCSSG LEWEDLALYS GKPIEFQEQI CFSMSSSGSN ALCGNDLGTC SSSKYPISCA  60
SHESTKPSMD YLGKVAHYKS TYEDLFSMHN LGGTFSSSPA GSVEPTIGLR LGIPKEYGDS  120
FFASSSSAKS SVSSLPVSSF PMKRSRASYH SLQNPCCQVE GCNLDLKSAK DYHRRHRICE  180
NHSKSPKVIV SGLERRFCQQ CSRFHELSEF DDKKRSCRRR LSDHNARRRR VQPESFQLNS  240
QGLPSALYGA SHKMEHNLLL NGFPISQTGA LDGPLCFSND EMRNSVSSLH LDSTRNIMDQ  300
GLHIPTTNSP IAPDLLGTAP SLLSSNTWTL NESETSPMQV FLRGNYLPTI SHLNSESYPL  360
SLFHPNNTSV SLPVSLMNTV NVTTDHPPEY QLFNSGNYFS GNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-281572301184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212229KKRSCRRRLSDHNARRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMap678339175
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093932.11e-100squamosa promoter-binding-like protein 12
STRINGVIT_11s0065g00170.t013e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA136441216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-44squamosa promoter binding protein-like 2