PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678338875
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 620aa    MW: 68422.7 Da    PI: 6.51
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678338875genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.22.7e-083934301954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp   ++  LA+++gL+ +qV++WF N R +
  678338875 393 FEHflHPYPCDVDKHILARQTGLSRSQVSNWFINARVR 430
                5544589*****************************88 PP

2BELL107.21e-34257325472
       BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                elq++k+kLl+++ eVd+rYk y++q++ v+ssFeavag g a++Y ++A+ka+SrhFrcL+d i++qi
  678338875 257 ELQRRKTKLLQMMVEVDRRYKYYCDQMRGVVSSFEAVAGTGGATVYSAMASKAMSRHFRCLRDGIVSQI 325
                89******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.9E-46194323IPR006563POX domain
PfamPF075262.2E-41199321IPR006563POX domain
PROSITE profilePS5007111.58371434IPR001356Homeobox domain
SMARTSM003897.9E-9374438IPR001356Homeobox domain
CDDcd000861.80E-11374435No hitNo description
SuperFamilySSF466891.33E-16375440IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-27377440IPR009057Homeodomain-like
PfamPF059201.2E-16391430IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MGEERAGFGY GNGSFPGNQN PHLVGFEAAP PEIYNLTAGM EMIGFQAKQG EPAAVMWKEL  60
FSKAAAAGGG AYNGGGSQSA GKDTLNEPGS SGFYHHDFRG ISDQNNHETL IDSPPPWSHH  120
PQQSSSRAFI PGDDHSLSSC VFPCEGNERP SQGLSLSLSS SNPSTIGLQH FELRQDMRFG  180
PSSSRSLNPP PQVFEAHSVL KNSRYLSPAQ ELLNEFCSLD TKEIMENSLR LKGQKPIEHQ  240
EEVIIKKQSL YSLDLLELQR RKTKLLQMMV EVDRRYKYYC DQMRGVVSSF EAVAGTGGAT  300
VYSAMASKAM SRHFRCLRDG IVSQIRATKK AIGDKDAAAP GTTKGETPRL RLLDQTLRQQ  360
RALQQMSLMD SHPWRPQRGL PERAVSVLRA WLFEHFLHPY PCDVDKHILA RQTGLSRSQV  420
SNWFINARVR LWKPMVEEMY LEELKENEGA ADIGGANMDC QNQQGMEDQK PTQDQLVRID  480
SECLTSILGS QEKHDLRKNK GLLNEQQAFI NSYNAMELDW QHAHHPASAV PYMNDTPGGA  540
IGFQSSGGGG VSLTLGLHQH GGASGSGIGF PSAAAPTSLF YSREQIEDCQ TEQYSLLDSE  600
NQALPYRNLM GAQLLHDLAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A1e-15380438563Homeobox protein Meis2
4xrm_B1e-15380438563Homeobox protein Meis2
4xrs_A9e-16380437158Homeobox protein Meis1
4xrs_B9e-16380437158Homeobox protein Meis1
5bng_A1e-15380438159Homeobox protein Meis2
5bng_B1e-15380438159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011029331.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-123BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A061G6K40.0A0A061G6K4_THECC; POX family protein isoform 1
STRINGPOPTR_0001s09720.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53001317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-98TALE family protein