PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678336424
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 247aa    MW: 28307.8 Da    PI: 4.7222
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678336424genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.46.9e-5461411128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..........kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                lppGfrFhPtdeelv++yLk+k++g ++el ++i+evd+yk+ePw+L             + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd+
  678336424   6 LPPGFRFHPTDEELVNYYLKRKIHGLEIEL-DIIPEVDLYKCEPWELVGdpkclvveksFLPSKDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDR 104
                79****************************.99**************6345677665543344778********************************** PP

        NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                +v+s +++++g+kktLv+y+grap+g +tdWvmheyrl
  678336424 105 KVTS-QRRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 141
                ****.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-614164IPR003441NAC domain
PROSITE profilePS51005586164IPR003441NAC domain
PfamPF023652.9E-307141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MSPVGLPPGF RFHPTDEELV NYYLKRKIHG LEIELDIIPE VDLYKCEPWE LVGDPKCLVV  60
EKSFLPSKDP EWYFFGPRDR KYPNGFRTNR ATRAGYWKST GKDRKVTSQR RAIGMKKTLV  120
YYRGRAPQGI RTDWVMHEYR LDDKGSDEAS GIQESYALCR VLKKNWLSTE VEGQGQSSNL  180
LLLDLTPTES ETLSPELPMA SSSSNIGNME EEDGNGKEDD EDESWMQFIR DGVCCGDELS  240
QMVFTNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-51116512166NO APICAL MERISTEM PROTEIN
1ut4_B3e-51116512166NO APICAL MERISTEM PROTEIN
1ut7_A3e-51116512166NO APICAL MERISTEM PROTEIN
1ut7_B3e-51116512166NO APICAL MERISTEM PROTEIN
3swm_A3e-51116515169NAC domain-containing protein 19
3swm_B3e-51116515169NAC domain-containing protein 19
3swm_C3e-51116515169NAC domain-containing protein 19
3swm_D3e-51116515169NAC domain-containing protein 19
3swp_A3e-51116515169NAC domain-containing protein 19
3swp_B3e-51116515169NAC domain-containing protein 19
3swp_C3e-51116515169NAC domain-containing protein 19
3swp_D3e-51116515169NAC domain-containing protein 19
4dul_A3e-51116512166NAC domain-containing protein 19
4dul_B3e-51116512166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678336424
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072043.21e-127NAC domain-containing protein 86 isoform X2
SwissprotA4VCM01e-82NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A068TRH51e-121A0A068TRH5_COFCA; Uncharacterized protein
STRINGEOY196881e-118(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-106NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]