PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678336203
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family Nin-like
Protein Properties Length: 355aa    MW: 40563.9 Da    PI: 6.2546
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678336203genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK77.21.8e-24263313252
     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                + +++++dl+ yF+lp+++AA+++++c+Tv+K+iCR+ G+ RWPhRkiks+
  678336203 263 TRSLKMKDLRDYFDLPMEEAARKMNLCPTVIKKICRKSGVGRWPHRKIKSI 313
                67899********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.086253334IPR003035RWP-RK domain
PfamPF020423.6E-21266313IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MDAEYAKYFQ ELLPPPQDIS FSSMFVDENP TLGLCELPLN QNQASLDATI HRNADAKGLS  60
HDSSFVTTFF NDTDEVIDLP TAAVPSFPFG ESSSCQNPAD TLPNFGFVVP ESQVSCICCQ  120
TLREITHFNG LEIQRLEIHG RLGTITHAVL SKHDLDSSLP TQHNQFIDFS MEGPKKVKKF  180
LLQYFKTCEE DGYFPLEDPL LPFYDALSVG LSVSRVSDDF NPSSPDNTDD SLKRRKEELK  240
PLDGESSAEC KKKISLSKQR ERTRSLKMKD LRDYFDLPME EAARKMNLCP TVIKKICRKS  300
GVGRWPHRKI KSIDGKISRK LKKLESKDED ERERARADIK KHQQELERIY QEYCR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLS8D6M14e-77S8D6M1_9LAMI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35052027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.12e-12RWP-RK domain-containing protein