PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678335921
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 295aa    MW: 32455.6 Da    PI: 7.3943
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678335921genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.92.3e-41147224178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cq+egC+adls+ak+yhrrhkvCe+hska +v+v gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+q 
  678335921 147 RCQAEGCNADLSHAKHYHRRHKVCEFHSKAGTVVVGGLTQRFCQQCSRFHVLSEFDNGKRSCRKRLADHNRRRRKSQR 224
                6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.6E-35143209IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.505145222IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.19E-39146224IPR004333Transcription factor, SBP-box
PfamPF031102.2E-31148221IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MLDYGWVSGE ETGQDSDNHH VYDPYGVQSY SEAANYGIPE VQFGAVAGAP NSLPFHGNPT  60
ANFQGFYEAP AVPPYQNPSM LTLEPSFPMG YMVVPKSEPA GSGFDFSSRL GLNLGGRTYF  120
ASAEDDFLSR LYRRSRILDT GTVNVPRCQA EGCNADLSHA KHYHRRHKVC EFHSKAGTVV  180
VGGLTQRFCQ QCSRFHVLSE FDNGKRSCRK RLADHNRRRR KSQRANEETS KSHIENTSDA  240
NSPSENMSRS PPESGQHSSS LTAAISLDHP PHRSYAGGCT TSSTASTSSL FYSND
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31140221384squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678335921
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090046.11e-116squamosa promoter-binding-like protein 8
TrEMBLA0A2G9HWN01e-124A0A2G9HWN0_9LAMI; Uncharacterized protein
STRINGMigut.B01572.1.p1e-106(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48462341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.19e-69squamosa promoter binding protein-like 8