PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678331489
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 301aa    MW: 34974 Da    PI: 6.5172
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678331489genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.63e-54191481129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kge 98 
                lppGfrFhPtd e+++eyL kk++++++++  +i e+d++k+ePwdL++k k +ekew+fF++rd+ky+tg r+nrat+sgyWkatgkdke++++  ++ 
  678331489  19 LPPGFRFHPTDTEIIMEYLLKKAADRRFDA-IAIGEADLNKCEPWDLHSKSKLGEKEWFFFFQRDRKYPTGMRTNRATESGYWKATGKDKEIYKEkaRRF 117
                79***************************9.88**************9888999****************************************844455 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                lvg+kktLvfykgrapkgektdWvmheyrle
  678331489 118 LVGMKKTLVFYKGRAPKGEKTDWVMHEYRLE 148
                5****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-6015170IPR003441NAC domain
PROSITE profilePS5100556.72219169IPR003441NAC domain
PfamPF023654.9E-2720147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MFAAGTSMDL QDEFDAAQLP PGFRFHPTDT EIIMEYLLKK AADRRFDAIA IGEADLNKCE  60
PWDLHSKSKL GEKEWFFFFQ RDRKYPTGMR TNRATESGYW KATGKDKEIY KEKARRFLVG  120
MKKTLVFYKG RAPKGEKTDW VMHEYRLEGD IFPRNATREE WVVCKVFHKN TACRRNPEVG  180
ASSLPQSDDY NEEDDHKGKF ILPQKGHFQN PISSWSSPYS PHATTMFYSH NTVHHQQFMD  240
PLYSMQNPAF SPSEETGVSN ESSMYYSRRE NEESKGGFAQ QLNDITPSPI DISDLDSFWS  300
Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-5351751171NO APICAL MERISTEM PROTEIN
1ut4_B4e-5351751171NO APICAL MERISTEM PROTEIN
1ut7_A4e-5351751171NO APICAL MERISTEM PROTEIN
1ut7_B4e-5351751171NO APICAL MERISTEM PROTEIN
4dul_A4e-5351751171NAC domain-containing protein 19
4dul_B4e-5351751171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078584.15e-95PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ9FLR31e-76NAC79_ARATH; NAC domain-containing protein 79
TrEMBLS8CVQ47e-84S8CVQ4_9LAMI; Uncharacterized protein (Fragment)
TrEMBLA0A0M4FBT58e-81A0A0M4FBT5_MANES; NAC transcription factors 78
TrEMBLA0A068VES11e-80A0A068VES1_COFCA; Uncharacterized protein
STRINGGLYMA19G28515.14e-78(Glycine max)
STRINGGSMUA_Achr6P08600_0016e-79(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.29e-82Arabidopsis NAC domain containing protein 87