PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678331113
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family Dof
Protein Properties Length: 274aa    MW: 29805.4 Da    PI: 9.4533
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678331113genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19.7e-393089261
     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
               ke al+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalrnvP+Ggg+rk+kk 
  678331113 30 KEPALRCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVPIGGGCRKSKKL 89
               567899***************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-263388IPR003851Zinc finger, Dof-type
PfamPF027012.4E-333388IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3483488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MSSGGKPVEN KHQNGSHSSA ARKHVAAREK EPALRCPRCD SPNTKFCYYN NYSLSQPRHF  60
CKTCRRYWTK GGALRNVPIG GGCRKSKKLK CSPRDTAADV GGLRVFPGIS PAMDFQINFQ  120
PRLNPAAPGL CNQFSSVGDQ GSYNFDPYCG GASSSTLMGL GFPLSSGYKP GEGANTTGFQ  180
EMGAQPNLEP PIESLSCINQ DLQWKIQQQR LSSFHQQPLS PLLFQNLEIS NAKQAHRKDN  240
GGTGNLATEW FFGNSYSAVA PSSTGNITNW SSFP
Cis-element ? help Back to Top
SourceLink
PlantRegMap678331113
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021274371.14e-83dof zinc finger protein DOF5.7-like
TrEMBLA0A061DI281e-80A0A061DI28_THECC; Dof-type zinc finger DNA-binding family protein
TrEMBLV4SKT92e-80V4SKT9_9ROSI; Uncharacterized protein
STRINGEOX918922e-81(Theobroma cacao)
STRINGXP_006426240.13e-81(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.18e-51Dof family protein