PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678331074
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CO-like
Protein Properties Length: 349aa    MW: 38097.1 Da    PI: 5.1439
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678331074genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.65.4e-086095337
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg.H 37
                ++C+ +e++++   C+ +   lC  C   +H+  H
  678331074 60 VWICEVCEQEPAAVTCKADAAALCVACDRDIHSAnH 95
               689*****************************6574 PP

2CCT62.11.8e-21294336143
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                R a++lRY+eKr++R+F+K++rY+sRKa+Ae+RpRvKGrF k+
  678331074 294 RVARVLRYQEKRRNRNFKKTVRYASRKAYAETRPRVKGRFMKR 336
                89**************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.241653IPR000315B-box-type zinc finger
CDDcd000217.34E-42062No hitNo description
SMARTSM003367.8E-1458105IPR000315B-box-type zinc finger
PROSITE profilePS5011910.77958105IPR000315B-box-type zinc finger
PfamPF006434.5E-660101IPR000315B-box-type zinc finger
CDDcd000211.28E-76198No hitNo description
PfamPF062032.5E-16294336IPR010402CCT domain
PROSITE profilePS5101715.666294336IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MEISDGGDLA AAGGESTAKP CDYCSSADAV VYCCKHSAFM CLSCDVRIHF ADTGARHGRV  60
WICEVCEQEP AAVTCKADAA ALCVACDRDI HSANHVARKH ERYPMVQFFG SAEAEAAKLE  120
ASTALFADDD QSAFNMDILE TKLDSWPPAD DTPEPATGDL DLKLIDFLFS EADRSTDFHN  180
FQLPYDSIDS VIPIESTTLL EEEEEEEEAA ASSHIHAPEV SFHIDFSKTN YSCHSQSACS  240
SFTSTTLSQS VSSSSAGVIT DGSSSEVSHP FPATGNISSV NAQGKQPHIV PNDRVARVLR  300
YQEKRRNRNF KKTVRYASRK AYAETRPRVK GRFMKRGGDA EHHPAAAKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMap678331074
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.18e-58CONSTANS-like 5