PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678330425
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family BES1
Protein Properties Length: 834aa    MW: 92151.9 Da    PI: 4.966
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678330425genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8221311.3e-40732082129
     DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr...kgskpl..eeaeaagssas...aspess 93 
                g +r ++++E+E++k+RER+RRai+aki+aGLR++Gny+l++raD+n+V++AL+reAGwvv +DGtt++   +g +p    ++ a  +s s   a+  ss
  678330425  73 GVRRCRPQEEKERTKLRERQRRAITAKILAGLRRHGNYNLRVRADINDVIAALAREAGWVVLPDGTTFPcrsQGVRPAggATNTALAASVSqipAENVSS 172
                5689999*************************************************************96667777775533333333433122233344 PP

     DUF822  94 lqsslkssalaspvesysaspksssfpspssldsis 129
                 ++   s   +s ++ + ++ k+  +p +s +d  s
  678330425 173 PSLGCISPGYKSTADYSFSQVKTAFVPTSSPYDASS 208
                444445555555555555555555556666555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.1E-3775204IPR008540BES1/BZR1 plant transcription factor, N-terminal
PfamPF013735.6E-75264616IPR001554Glycoside hydrolase, family 14
Gene3DG3DSA:3.20.20.802.0E-143265623IPR013781Glycoside hydrolase, catalytic domain
SuperFamilySSF514451.81E-129265627IPR017853Glycoside hydrolase superfamily
PRINTSPR007502.7E-47269290IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-47362384IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-47435454IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-47469485IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-47486497IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-47504527IPR001554Glycoside hydrolase, family 14
PRINTSPR007502.7E-47545567IPR001554Glycoside hydrolase, family 14
Gene3DG3DSA:2.60.120.104.7E-14629734IPR014710RmlC-like jelly roll fold
SuperFamilySSF512068.12E-15631734IPR018490Cyclic nucleotide-binding-like
SMARTSM001003.2E-4639758IPR000595Cyclic nucleotide-binding domain
CDDcd000381.85E-12639732No hitNo description
PROSITE profilePS5004212.834639709IPR000595Cyclic nucleotide-binding domain
PfamPF000271.6E-7658734IPR000595Cyclic nucleotide-binding domain
Gene3DG3DSA:3.10.129.101.6E-18756822IPR029069HotDog domain
SuperFamilySSF546377.08E-12757822IPR029069HotDog domain
CDDcd034452.86E-16769823No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0009570Cellular Componentchloroplast stroma
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 834 aa     Download sequence    Send to blast
MMPAQMQRFG ISDEDDGDMG MDVKAEDDDD DEDEEKNMET PSVVDMHVGV LSTSSLYVNQ  60
QHYQDQPVTQ VSGVRRCRPQ EEKERTKLRE RQRRAITAKI LAGLRRHGNY NLRVRADIND  120
VIAALAREAG WVVLPDGTTF PCRSQGVRPA GGATNTALAA SVSQIPAENV SSPSLGCISP  180
GYKSTADYSF SQVKTAFVPT SSPYDASSSG RSHTSAMMGD GGELLNDALL GVSVDSGDDR  240
QVVDVPIKLQ GRDFSGTPFV PVFVKLPVLL SFHECGSNVG DDVCIPLPNW VTNIGQSNPD  300
IYFTDRAGRR NPECLSWGVD KERVLGGRTP VEVYFDYMRS FRVEFDGYFE DATISLIVIG  360
LGPCGELRYP STPVKHGWQY PGIGEFQCYD QYMLKSLRKA TEIRGQPCWA RGPENSGAYN  420
SSPHETGFFC DGGDYDGYYG RFFLTWYSQL LVDHGDRILS LAKLVFEETC IAAKISSIQW  480
WYKTVSHAAE LTAGYYNSSH RDGYAAIMKM LGSHGAGLFF VNSEIMTAID HPTDYSESMA  540
DPTGLAWQVL NSAWDAGIPI SSQSSFPYNG EDEYAHLLEK AKPLGHPDGK HFLSFTFLRL  600
NPLLMERHTL DELESFIKKM HGKGLLASAV MEFLGCVPLL QRLPASSLMK IAGLVSVRHY  660
DEGASVLREG EVIDGIYFIW EGEAEVSGPF HADREDSSEF ILKQYDYFGH GLASNQSADI  720
IALSKLTCLF LPNKYANLLK PGSIWNADKL EERCPLVEQI LHLDPIEVDI FKGITLPNAP  780
RFGKVFGGQF VGQALAAASK TVDCLKFVHS LHTYFLLAGD VDSSDKRLVI VLES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1v3i_A2e-9626462284443Beta-amylase
1wdq_A2e-9626462284443Beta-amylase
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678330425
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025887684.10.0beta-amylase 7 isoform X4
SwissprotO808311e-171BAM7_ARATH; Beta-amylase 7
TrEMBLA0A371EL520.0A0A371EL52_MUCPR; Beta-amylase (Fragment)
STRINGLPERR09G16130.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16072448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.11e-160beta-amylase 7
Publications ? help Back to Top
  1. Soyk S, et al.
    The Enzyme-Like Domain of Arabidopsis Nuclear β-Amylases Is Critical for DNA Sequence Recognition and Transcriptional Activation.
    Plant Cell, 2014. 26(4): p. 1746-1763
    [PMID:24748042]