PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678327049
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 290aa    MW: 31191.1 Da    PI: 7.0217
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678327049genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.81.6e-3084137155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  678327049  84 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 137
                59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-2081141IPR009057Homeodomain-like
PROSITE profilePS5129411.05981140IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-3083142IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-2485137IPR006447Myb domain, plants
PfamPF002491.1E-787136IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MREADSNWFS NWEDELPSPE DLIPLSQSLI TPDIALAFNI PTPHHAPPPR LPQPNSSAEF  60
ESPDGGGGPS GGSGSDEQAR TLKRPRLVWT PQLHKRFVDA VAHLGIKNAV PKTIMQLMSV  120
DGLTRENVAS HLQKYRLYLK RMQGVSNGGI SSAGGAGSPS AALAAVGMDP ATDHLFASSP  180
VPPHFLHPGR GNSDHYLPFV PAPPHQQHPP QISMAPAPLQ FRQFGSSPRD GQFEHPFLTQ  240
SQAQIQRLST PAHNGNGTPL LPPAFVEDLD SATPRKALTL FPTAGDLSLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-2183142463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070088.11e-123PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB47e-49PCL1_ARATH; Transcription factor LUX
TrEMBLM1CPV31e-107M1CPV3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000722131e-107(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24322354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.13e-65G2-like family protein