PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678326423
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CO-like
Protein Properties Length: 450aa    MW: 48911.1 Da    PI: 6.1902
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678326423genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box29.31.7e-09159204342
   zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                 ++C+ +e+ ++ + C+ +   lC++C   +H+       H+++p+
  678326423 159 VWVCEVCEQAPAAFTCKADAAALCPTCDRDIHSAnalarrHERIPV 204
                689*****************************66889999999885 PP

2CCT69.39.6e-24386429144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  678326423 386 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 429
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.2E-10114161IPR000315B-box-type zinc finger
PROSITE profilePS501199.385114161IPR000315B-box-type zinc finger
CDDcd000211.42E-7118161No hitNo description
PROSITE profilePS5011910.594157204IPR000315B-box-type zinc finger
PfamPF006431.8E-7159204IPR000315B-box-type zinc finger
CDDcd000211.24E-7160204No hitNo description
SMARTSM003361.9E-8162204IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787386428IPR010402CCT domain
PfamPF062037.4E-18386428IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MASNKLVQMA PVIHIAACPQ FLASHVPVEV DPAVAGRRFL PSAVSSCPGD KPDAFAPTVP  60
RVNSLIVIRK VEDGAYLFLS PTSLPYRKPL WVSFYRGLIL SEQSSPPSMG GWSLTAKLCY  120
FCKAVPASVF CRADSAFLCV PCDGRVHAAN KLASRHARVW VCEVCEQAPA AFTCKADAAA  180
LCPTCDRDIH SANALARRHE RIPVVPFYDA ASATKSTDPP SAQEDFSEEE AEAASWLLPD  240
PDCKTAAAAE DPGSPEYKSA EYLFNEMDNP YLDLDLIAGD QKPGHHGDAA DEKQIYSSDG  300
VVPVQHKSEF DSAVQYPGPV VDGYPSYDVE YPSTKPLMYS FSSQGVSHSL SSSSVDVGVV  360
PDQADVSNTY GKNDGGVPVP VSGVDREARV LRYREKRKNR KFEKTIRYAS RKAYAETRPR  420
IKGRFAKRTE LEADSLIGQD ASSYGVVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078988.11e-160PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T99e-91COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A068L9I61e-154A0A068L9I6_9MYRT; Zinc finger protein CONSTANS-LIKE 3
STRINGPGSC0003DMT4000755201e-140(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-84CONSTANS-like 4