PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678325715
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CO-like
Protein Properties Length: 333aa    MW: 36269 Da    PI: 4.7664
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678325715genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box279.3e-095495338
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                ++C+ +e+++++  C+ +   lC+ C   +H+       H+
  678325715 54 VWICEVCEQEPATVTCKADAAALCAVCDRDIHSAnplarkHD 95
               689*****************************6566666676 PP

2CCT62.71.1e-21286328143
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                R a++lRY+eKr++R+F+K++rY+sRKa+Ae+RpRvKGrF+k+
  678325715 286 RVARVLRYQEKRRNRNFKKTVRYASRKAYAETRPRVKGRFTKR 328
                89***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.291047IPR000315B-box-type zinc finger
CDDcd000213.70E-41356No hitNo description
PROSITE profilePS5011910.6655299IPR000315B-box-type zinc finger
SMARTSM003367.7E-155299IPR000315B-box-type zinc finger
PfamPF006431.5E-65496IPR000315B-box-type zinc finger
CDDcd000218.74E-85599No hitNo description
PfamPF062031.8E-16286328IPR010402CCT domain
PROSITE profilePS5101715.696286328IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MDSNSHGGES TARQCDYCRA ADAVVYCCNH SGFMCLPCDV RVHFADTGPR HGRVWICEVC  60
EQEPATVTCK ADAAALCAVC DRDIHSANPL ARKHDRYPMV QFFGSAEAEA AKLEASAALF  120
ANDDGGADDE DNVFDMDALE KKLDSWIPAD DTPGPATDNL DLKLIDFLFS EADKSIDFDN  180
FELPYDSRDS AIPLESTTLL DDAAASRIHA PEISFDMDFS NPSYSCYSQS ACNSFTTATL  240
SQSVSSSSVG VVNDGSSGSA SETSHPIAAA GNIPSGKQPN IVPNDRVARV LRYQEKRRNR  300
NFKKTVRYAS RKAYAETRPR VKGRFTKRGG DPE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.14e-58CONSTANS-like 5