PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678325446
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CO-like
Protein Properties Length: 336aa    MW: 37695.1 Da    PI: 8.2108
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678325446genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.56.5e-091255339
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg.......Htv 39
               +r C+ + + +++++C  ++ +lC++C ++ H+        H+v
  678325446 12 ARACDYCVKTRARWYCAADDAFLCQSCDSSVHSAnlvarrhHRV 55
               678*****************************668888886655 PP

2CCT63.75.5e-22286328143
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                Rea+++RY+eKr +R+F+KkirYe+RK +Ae+RpR+KGrF k+
  678325446 286 REARVSRYREKRLRRLFSKKIRYEVRKLNAEKRPRMKGRFIKR 328
                9***************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.3E-81057IPR000315B-box-type zinc finger
PROSITE profilePS5011910.5371057IPR000315B-box-type zinc finger
PfamPF006435.5E-71255IPR000315B-box-type zinc finger
CDDcd000217.72E-101357No hitNo description
PfamPF062034.0E-17286327IPR010402CCT domain
PROSITE profilePS5101715.537286328IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGASPAAGAK SARACDYCVK TRARWYCAAD DAFLCQSCDS SVHSANLVAR RHHRVRLKKE  60
WLKHSLEVSV PIWHRGFCRK ARTPRQKRIA AEEASTVPEN SGGEESPVKN EADRLYQVPS  120
FDDGEKTGYS SLQALNDFLH SDTDLDEFAA DVESLLGKGV ENETLQMSEL GIWERERVIK  180
VENEAIAGNC SDHQPPRPFE SDPGYDSPNA GDRDHSSKPD DSNKVFLELN YEGVLSSWGT  240
TRSPWTTGER PDSNSTHCWL PDCTGCCGKM HGYGTTGTAN GDDGGREARV SRYREKRLRR  300
LFSKKIRYEV RKLNAEKRPR MKGRFIKRLI PIAPMG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076793.11e-111PREDICTED: zinc finger protein CONSTANS-LIKE 16
SwissprotQ8RWD06e-75COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A022QHL26e-97A0A022QHL2_ERYGU; Uncharacterized protein
STRINGVIT_01s0011g03520.t011e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15392470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.13e-66B-box type zinc finger protein with CCT domain