PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678323129
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 397aa    MW: 44128.5 Da    PI: 5.0432
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678323129genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1614.5e-5061331128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPtd elv++yLk+kv+gkkl++ e+i+ev+iy++ PwdLp  +++k++++ew+fF++r+kkya+g r +rat++gyWk+tgk ++v + +g+
  678323129   6 LPPGFRFHPTDTELVMYYLKRKVTGKKLHF-EAIAEVNIYQFSPWDLPdmSCLKSKDREWFFFCPREKKYASGVRVKRATENGYWKTTGKGRPVSH-NGQ 103
                79**************************99.89**************9644889999**************************************9.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 vg+ ktLvf+ g++p+g++tdWv+heyr+
  678323129 104 IVGMVKTLVFHLGHSPNGRRTDWVIHEYRI 133
                ****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-574155IPR003441NAC domain
PROSITE profilePS5100554.5796155IPR003441NAC domain
PfamPF023654.2E-267133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MGKAFLPPGF RFHPTDTELV MYYLKRKVTG KKLHFEAIAE VNIYQFSPWD LPDMSCLKSK  60
DREWFFFCPR EKKYASGVRV KRATENGYWK TTGKGRPVSH NGQIVGMVKT LVFHLGHSPN  120
GRRTDWVIHE YRIVDKAIAS ADHLETYTLC KVFEKSGMGP KNGAQYGAPF NEAEWSDDED  180
EPVKIQSPAL ETQLPQCQGV PSLSAGQLST DVPVIENDHE IEHMLSHFTD DPIFSLDAAS  240
KQGAHVEAVK SHPSSDGFDL YDGLDDLDIH PRLNEDHLYL SGMHHENNEL NPLFLDEMGY  300
IELDDLMGPL TSSAEELLFG CYGANRFQQL NHQGTGLNQY PLSSAPLPPF PTGTMGTAGN  360
PELPQTTMPS TSGCYELLPA SNAATACGSE QLPPPQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-46615615169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012853700.11e-115PREDICTED: NAC domain-containing protein 89-like isoform X2
SwissprotQ9FY828e-83NAC82_ARATH; NAC domain-containing protein 82
TrEMBLS8E9C01e-119S8E9C0_9LAMI; Nam-like protein 2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60502334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.42e-83NAC domain containing protein 82