PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678321246
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 387aa    MW: 42788.2 Da    PI: 7.7265
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678321246genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like56.94.5e-18201251555
    G2-like   5 rWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                +Wt+eLH++Fv a ++     +  Pk+i+e mkv+gLt+ +v+SHLQk R 
  678321246 201 DWTEELHAKFVAACNEFPDGTECFPKEIMEKMKVEGLTRMQVASHLQKCRN 251
                7****************99999**************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521727.83E-1220148IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.8E-1225153No hitNo description
PROSITE profilePS5011015.5627141IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF466893.23E-11196250IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-17196251IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-16200252IPR006447Myb domain, plants
PfamPF002496.9E-6201249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MWEGCDFRLD PWGASPAYPA VVHGGVHVLV VDHDKEGLCY TTNMLVQCGY QVTPIEYASP  60
ALGLLYSGES NFDAVIAPDV SPDPSNSILV QNAVAMGIPV ALMTVDDNQG AVVKALERGA  120
FLCMKKPATM KVLGVLWQHV VRERMRTLRE RDAMMAATAD LRFAEGPSSD YAHKVSGRKK  180
HGYYQQQQST SNNIRKKMCT DWTEELHAKF VAACNEFPDG TECFPKEIME KMKVEGLTRM  240
QVASHLQKCR NENWKSPDQR RNQGANSPSG SNPGSNQPRP RRFGAKPVFN KHNPSSPSIS  300
SRTENCSSTQ PPSSIADSGD RSLPPNRSQD TIHNPPAPYS RYPQQPGNEY TPESLHIAVE  360
SQRCFTTDGD VKPPLTLSFL PPAEKEK
Cis-element ? help Back to Top
SourceLink
PlantRegMap678321246
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.15e-26response regulator 2