PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678318686
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 147aa    MW: 15731.5 Da    PI: 10.0436
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678318686genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM35.33.4e-112150130
        NAM  1 lppGfrFhPtdeelvveyLkkkvegkklel 30
               l+pGfrFhPtdeelv +yLk+kv gk+++ 
  678318686 21 LAPGFRFHPTDEELVRYYLKRKVCGKDHSK 50
               579*********************999554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-101449IPR003441NAC domain
PROSITE profilePS510059.76621147IPR003441NAC domain
PfamPF023651.3E-82354IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MGISTAAVEK KSRSSVSSSM LAPGFRFHPT DEELVRYYLK RKVCGKDHSK ELDDSSSWSK  60
AKLSGMGKKE DASDGSVAGR SSSKEKKPSD AWGMKPAVAD GWRVGGSSGK KEKPSDAWGS  120
KSDAADCWGP GGSSRKEEKP SDAWKQA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.13e-13NAC domain containing protein 2