PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678317422
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 386aa    MW: 41798.6 Da    PI: 9.8228
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678317422genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.93.9e-32223276255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  678317422 223 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 276
                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15220276IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28221276IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-24223276IPR006447Myb domain, plants
PfamPF002495.4E-7224275IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MPMDGIFLEP CSSSASSQIP DLSLQIRPPN CDATSSPSRT HNKSVFDVSH GGAALTELSL  60
ASNTLKQQNP FRPSSQLQLQ QHRHGDFDSS SSCPPPPLPI KGIPVYGGSS KRGPLSFLSP  120
LDHQKEGANK MRFYPMFSSS SAPSTHPYFA AGGGGGGASE NPMLVRPNAS PPPYYHGGPA  180
SSRFAAGYQS GFSGIIPIPL QPHDHMRSRF LPKTPPKRSM RAPRMRWTSS LHARFVHAVE  240
LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKTT DKPPPTSGYS DGSGEDDLST  300
VGSGGERPIR NRQFNDRRNH QQQEADTNHP STNATLWSNS SSSRDSWLQM NAGEPAGPMG  360
SSSFSASPDH HLVRKTPSKG TCEVQF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085885.18e-88PREDICTED: transcription repressor KAN1
TrEMBLA0A0V0IFG92e-74A0A0V0IFG9_SOLCH; Putative transcription repressor KAN1-like
STRINGPGSC0003DMT4000346631e-72(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-48G2-like family protein