PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678317270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family Dof
Protein Properties Length: 255aa    MW: 28512.1 Da    PI: 9.2763
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678317270genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.8e-392382362
     zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
               e +l+cprCds ntkfCyynnyslsqPr+fCk+CrryWt+GGalrnvP+Ggg+rk+kk++
  678317270 23 EPSLRCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTRGGALRNVPIGGGCRKSKKMK 82
               56789***************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-262380IPR003851Zinc finger, Dof-type
PfamPF027015.7E-332580IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3572680IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSGDEGKPEQ QRRKKSAAAR AQEPSLRCPR CDSPNTKFCY YNNYSLSQPR HFCKTCRRYW  60
TRGGALRNVP IGGGCRKSKK MKGSSKDVGG LRFFQGISPA MDFQSASQFA DISNNHPILA  120
TPPPSFSLDP NYAGTSFGMP FKPANLTALF QEPGGSYRSL ASSIESLSCM NQDLHWKLQQ  180
QRLAPNFITP SIEAPPAETT TLQKCQPLLF HNLEISSNKQ QQSDDVRNPT ELFFDTHYAT  240
TAAIWSNIQS WTDFP
Cis-element ? help Back to Top
SourceLink
PlantRegMap678317270
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022842998.18e-74dof zinc finger protein DOF5.7-like
TrEMBLA0A1U8N7462e-71A0A1U8N746_GOSHI; dof zinc finger protein DOF5.7-like
STRINGGorai.008G094000.11e-71(Gossypium raimondii)
STRINGXP_009774290.11e-71(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.13e-55Dof family protein