PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678315443
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 282aa    MW: 31783.6 Da    PI: 7.222
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678315443genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.21.4e-31180235156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k r++W++eLH+rF++a++qLGG++ AtPk+i+elm+v+gLt+++vkSHLQkYR++
  678315443 180 KVRRCWSTELHRRFIHALQQLGGAQAATPKQIRELMQVDGLTNDEVKSHLQKYRVH 235
                679***************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.713177237IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-28178238IPR009057Homeodomain-like
SuperFamilySSF466896.81E-17178238IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-25180235IPR006447Myb domain, plants
PfamPF002491.0E-7182233IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGSPVSPELN LGSDRPLEKW VLGADTRKSS NLQDYVARLQ DEMKKIEAFE RELPLCMLLV  60
KDEIARLSKE AEKSNCNHPA LEFLPLKTGQ FEKTVEVTEK ENRDKLNWMS SVQLWNCGDH  120
QIHDSTSNKK GVDDSDVLQG NSKNSETPLL SLCISGSSPR SSSATSSATD AKLNPRISRK  180
VRRCWSTELH RRFIHALQQL GGAQAATPKQ IRELMQVDGL TNDEVKSHLQ KYRVHVRRGS  240
ASKDPYYDST KRTKTQSLLP LVPESSTPED KEEDDTSEIH NQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011458328.13e-57PREDICTED: uncharacterized protein LOC101303079
TrEMBLA0A0A0LIJ11e-56A0A0A0LIJ1_CUCSA; Uncharacterized protein
STRINGPOPTR_0009s10980.15e-53(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA84972229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-33G2-like family protein