PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678311607
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 408aa    MW: 44585.8 Da    PI: 6.9325
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678311607genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.77.3e-2595148155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kp++ Wt+ LH++F+ea++++ G e+A+Pk+ile+m+v+gLt+e+v+SHLQkYR+
  678311607  95 KPKIIWTNSLHNHFLEALRSI-GLERAVPKRILEVMNVPGLTRENVASHLQKYRI 148
                799******************.********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-1893152IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.8E-2593152IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-2495148IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MHRCLVGIQL LLSSISFTGD QTSSEGMTTN PSNGHGSSSE TVTSMKKIIE VEEEGSVSIE  60
KTATASSSVA ASNRNDRKKE SSRKGKSSLS FSQRKPKIIW TNSLHNHFLE ALRSIGLERA  120
VPKRILEVMN VPGLTRENVA SHLQKYRIFL KRVSDASIKM QNRVGDAPSL WPCNAVPAPC  180
FKVSPRRPME SPVKASVSKC VEASSMRSSS FIPAQLDHSL AWSNQQTPIS SMNSGDVSSN  240
PMACFSNQML NNHHPSFPAI ERNALLSWDS LANFGFPSCD LESINHVAGS GQPEKNKGLD  300
SSPCSVFFTR DQLGQHTGLP GSPPDNSGEG LLSDVVAEYG FRVQNIQRIN HQSDGALKSD  360
LFTASSDHRS LQNEQNEEEM APPCCTNCDD FNDWESLLQS LGQPNYQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-2392154264ARR10-B
Cis-element ? help Back to Top
SourceLink
PlantRegMap678311607
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24322354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31920.11e-24response regulator 10