PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678302010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 409aa    MW: 46112.2 Da    PI: 10.0791
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678302010genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.5e-41145221278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                C v+gC+adls  ++yhrrhkvCe+hsk+pvv+++g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  678302010 145 CLVDGCHADLSLGRDYHRRHKVCEAHSKTPVVTIAGREQRFCQQCSRFHSLVEFDEAKRSCRKRLDGHNRRRRKPQP 221
                **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-33138206IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.804142219IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.79E-38143224IPR004333Transcription factor, SBP-box
PfamPF031105.7E-31145218IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MNLNRGTYFL SSTIRKADGI RSRVRVREKR RRVGPRGFPR DKKEWGGPPF LSLFLLLLLG  60
LSTQDFRFTF PISLILALSL LGSPTCQGYL EGPAEPDTKV SVGNTEFTTI CKAVPYLMED  120
ESSSSSTKRA KPPSSSTSQS QVPNCLVDGC HADLSLGRDY HRRHKVCEAH SKTPVVTIAG  180
REQRFCQQCS RFHSLVEFDE AKRSCRKRLD GHNRRRRKPQ PESVAPNSRF PPFGCAQMMR  240
PSVLPPAWPG FIKTENDLAL CSNQRRTESF LKFPFKGIDH HQHQQQFHFD ETSISSMPSD  300
PRFFNERRNL QVVETQGAPS LLSTSPQATE EFNLNRRYRN EGAMPPSTTQ AMAHGFNFGP  360
FHQFPQDIKP VVSSAQIHGT TLHFPEMFQH GGASSSGGGS HQTLSFMWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-28136218284squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12832KRRRV
2201218KRSCRKRLDGHNRRRRKP
Cis-element ? help Back to Top
SourceLink
PlantRegMap678302010
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G9FXF56e-73A0A2G9FXF5_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.13e-43SBP family protein