PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678301545
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family WRKY
Protein Properties Length: 160aa    MW: 18343.4 Da    PI: 8.4652
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678301545genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.42.2e-3181139159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r++ d+ vv++tYeg H h+
  678301545  81 LDDGYRWRKYGQKAVKNNRFPRSYYRCTFQGCRVKKQVQRQSCDEGVVVTTYEGIHSHP 139
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.0E-3369140IPR003657WRKY domain
SuperFamilySSF1182901.44E-2874140IPR003657WRKY domain
PROSITE profilePS5081130.13676141IPR003657WRKY domain
SMARTSM007745.5E-3681140IPR003657WRKY domain
PfamPF031062.2E-2582139IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MDNYSYLFRS SSSASPQFSL VNMSNNQHHH VLGGFSSSFV GFEGSGSPQM INECGVSEQQ  60
EKKEDTSGRF AFKTRSEVDI LDDGYRWRKY GQKAVKNNRF PRSYYRCTFQ GCRVKKQVQR  120
QSCDEGVVVT TYEGIHSHPV QRCADDLQHI VAQMQIYPSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-2866138274Probable WRKY transcription factor 4
2lex_A1e-2866138274Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615508.18e-55PREDICTED: probable WRKY transcription factor 75
RefseqXP_016446514.18e-55PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA24e-49WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLW8E2P55e-52W8E2P5_MALBA; WRKY75
STRINGPOPTR_0001s33560.16e-51(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22042461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.15e-50WRKY DNA-binding protein 75