PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678300674
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MIKC_MADS
Protein Properties Length: 287aa    MW: 32574.1 Da    PI: 7.6401
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678300674genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.51.4e-3173123151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  678300674  73 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 123
                79***********************************************96 PP

2K-box69.11.4e-231412241295
      K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                ++ +s+++e+ kLk+++e Lq+ qR+llG+dL+sL+l++L+ +e+qLe+sl  iRs++++l+++  + l +k +e+  + ++ +
  678300674 141 STLQSSYKEYLKLKARYEALQQYQRQLLGDDLGSLNLNDLEAIEHQLESSLGLIRSTREKLMMDANNALERKLEEIYAASQMQQ 224
                567999******************************************************************999887776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554556.8E-3065130IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-4165124IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.20765125IPR002100Transcription factor, MADS-box
CDDcd002652.96E-4066124No hitNo description
PROSITE patternPS00350067121IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-326787IPR002100Transcription factor, MADS-box
PfamPF003192.9E-2674121IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-3287102IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-32102123IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.461143234IPR002487Transcription factor, K-box
PfamPF014867.4E-18144218IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MWHGDQSASA HPSIHHHAHL PPREPQRFFK TTARGLKGAA VGVGEVDLWV ESKGKLQNYE  60
EIHIMGRGRV ELKRIENKIN RQVTFAKRRN GLLKKAYELS VLCDAEVALI IFSNRGKLYE  120
FCSSPEYYLL IPTFRVLDLA STLQSSYKEY LKLKARYEAL QQYQRQLLGD DLGSLNLNDL  180
EAIEHQLESS LGLIRSTREK LMMDANNALE RKLEEIYAAS QMQQQTWIAG QQCNAFGHQH  240
PHSQSFFQPL DCNSSLQIGC DDPVTSSQMT GASNSQTLNG LLPVWML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A5e-1866124159Myocyte-specific enhancer factor 2A
3mu6_B5e-1866124159Myocyte-specific enhancer factor 2A
3mu6_C5e-1866124159Myocyte-specific enhancer factor 2A
3mu6_D5e-1866124159Myocyte-specific enhancer factor 2A
5f28_A6e-1865124160MEF2C
5f28_B6e-1865124160MEF2C
5f28_C6e-1865124160MEF2C
5f28_D6e-1865124160MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678300674
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099041.11e-110developmental protein SEPALLATA 1 isoform X2
SwissprotQ8LLR26e-86MADS2_VITVI; Agamous-like MADS-box protein MADS2
TrEMBLS8EDZ41e-102S8EDZ4_9LAMI; Uncharacterized protein
STRINGPGSC0003DMT4000034836e-94(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.16e-68MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]