PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678299338
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 342aa    MW: 39076.7 Da    PI: 7.1708
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678299338genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.54.8e-48411702128
        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +pGfrF Pt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp +    ++ +ekewyf+++rdkky++g+r+nr+tksgyWkatg d+ + s++ 
  678299338  41 MPGFRFYPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPdErsaLAAIGEKEWYFYVPRDKKYRNGDRPNRVTKSGYWKATGADRMIRSESL 139
                79***************************.89**************9535543344999***************************************99 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                + +g+kktLvfy+g+apkg +t W+m+e+rl
  678299338 140 RSIGIKKTLVFYSGKAPKGIRTGWTMNEFRL 170
                *****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-5340191IPR003441NAC domain
PROSITE profilePS5100553.91340191IPR003441NAC domain
PfamPF023658.2E-2442170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MAIEATCLMS TRQEEESNDK DRHSRAAAAP PVDEHEQDAV MPGFRFYPTE EELIEFYLRR  60
KVEGKRFNVE LITFLDLYRY DPWELPDERS ALAAIGEKEW YFYVPRDKKY RNGDRPNRVT  120
KSGYWKATGA DRMIRSESLR SIGIKKTLVF YSGKAPKGIR TGWTMNEFRL PIHETERHQK  180
AEISLCRVYK RPGIEDHASI PRSIPRSKGS QPAMSQAPPA KQEAASRSMQ DDEETMAFPH  240
FKPPSSSSNS STIYRNSNVD DLHKLVNGVS FRHPEAESHE NPHFSTPVGP ISLVSYFPTP  300
QPQPEATPMT AGPDNPGSSH VTYPWDWKDI HDGSKDFTAL FK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-53321919165NO APICAL MERISTEM PROTEIN
1ut4_B1e-53321919165NO APICAL MERISTEM PROTEIN
1ut7_A1e-53321919165NO APICAL MERISTEM PROTEIN
1ut7_B1e-53321919165NO APICAL MERISTEM PROTEIN
4dul_A1e-53321919165NAC domain-containing protein 19
4dul_B1e-53321919165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301581.11e-110PREDICTED: NAC domain-containing protein 48
RefseqXP_011092242.11e-110PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9FIW52e-58NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A068TNX51e-117A0A068TNX5_COFCA; Uncharacterized protein
STRINGGLYMA17G00650.21e-108(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38882446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-104NAC domain containing protein 35