PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678296295
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family Nin-like
Protein Properties Length: 291aa    MW: 33092.5 Da    PI: 5.9482
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678296295genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.15.6e-26119168352
     RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                +++s e++s+yF+lpi++AA eL+v++T+LK++CR++GIkRWPhRk+ sl
  678296295 119 SRLSKEMISQYFYLPIAKAAEELKVGVTYLKKRCRELGIKRWPHRKLMSL 168
                6899*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.552102188IPR003035RWP-RK domain
PfamPF020423.2E-21121168IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MPMALQDYQV QEYEQVFAFP LLYDFSDSGL HDWDFYGGIG TLDLLLTDDA PSCHPQEGFL  60
WDSSLWEDIN SASSQKQQMT LKSSGEDGAK GGESPCPENP IVGKKTSRRV HRKDETRASR  120
LSKEMISQYF YLPIAKAAEE LKVGVTYLKK RCRELGIKRW PHRKLMSLQT LIHNVQELGK  180
ERRGVLGDEY THILEEEKKL MEEIPDLRLD DRTKRLRQAC FKANYKKRKL MGMAVSFPRK  240
PSSSNQQVDA IDEGHVSSVG STGAEVDDEE IKCLIEGFCS SASSDVELLK Y
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071711.11e-54PREDICTED: uncharacterized protein LOC105157108
TrEMBLA0A068UVI12e-50A0A068UVI1_COFCA; Uncharacterized protein
TrEMBLF6GT766e-51F6GT76_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g06250.t012e-50(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.15e-30RWP-RK domain-containing protein