PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678292470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 980aa    MW: 109093 Da    PI: 8.263
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678292470genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP122.51.8e-38154231178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cqv++C+++l ++k+yhrrhkvCevhska++vlv++++qrfCqqCsrfh l +fDe+krsCrrrLa+hn+rrrk+q+
  678292470 154 ICQVDDCTENLCTTKDYHRRHKVCEVHSKAKNVLVRKQMQRFCQQCSRFHPLLDFDEGKRSCRRRLAGHNKRRRKSQP 231
                5**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.6E-30147216IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.487152229IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-34153233IPR004333Transcription factor, SBP-box
PfamPF031105.3E-28155228IPR004333Transcription factor, SBP-box
SuperFamilySSF484036.13E-7760893IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.5E-5773903IPR020683Ankyrin repeat-containing domain
PROSITE profilePS502978.879837907IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 980 aa     Download sequence    Send to blast
MEGVSAQVAA PVVIHQKPAP VRHPLTKKRD LPLDSSGSVH ENSSGSWNTK CWSWDSTSFI  60
ASPLQTEGVK PGKGDHISAV LRRKFDLVCD SVKLKQSSNS SQGDHNQYDS LGDGDEPGKS  120
VSNDGLDPIE EPEQVLKPSK RVKMVSSGGS DHPICQVDDC TENLCTTKDY HRRHKVCEVH  180
SKAKNVLVRK QMQRFCQQCS RFHPLLDFDE GKRSCRRRLA GHNKRRRKSQ PEDGKVHGRV  240
PGSQPDYIDR GGDIINRLSV LTHGEGTAKR MIKFSRAPGE DQQVQVLSRL NSLPFQVSLP  300
PKRAHQKTME GIVQDGVVSE NQNQTPRNDS CPSTRDFMCV LASDPAAHSS SSFGIQSLPS  360
TGKFDLEKSK STCAEQVGFV SIQGSIRALD GPGGGRRNEN IALEMSDNLW LHMSRSSPED  420
TASRNFPSNR IITSCNSSDH SAEKSPASSP PLHDLFPLQA SRETCKDGVL SKCEDKILCM  480
QKDQKERTCL QLFGQSVQAT EDGSVQSSSC RAATCPSTSG SDQSPYSMNV DVKERSSRII  540
VKLFGKDPSC LPTSLRTQIY NWLSKSPSDM ESYIKPGCVI ISFYLSMPSS TWDRLEEKFS  600
DYVNSLVKDI DMDFWGHGRF LVSSGSVMVS LKDGYTAHTQ MDLASRKTAV LLYKTMVTMR  660
YTWMALRSAI QRAVLLVVVL LRGFSYFPII IADQAICHEL RFLESELHVE FENKGKLYDR  720
RKRVLHFLDE LGWLFQRKSS SCSSEIHENS LCRFKSLLIF CVEHDFCALM RALLDILLEV  780
TQEVEWETLM EDHLLIRAVK KQSFPMVNLL INYSVVSSSS GSQQLTYIFT PDAPGPGGAT  840
PLHLAACTSS SPDLVDALTN DPQEVGLRSW NSILDEKGHS PYAYAVIRNH HSYNALVARK  900
LAERNNDQVS VLIPKKLPSS CSKCTILAAG RYQIKPRPYA RSMLAIATVC ACVCIILRLH  960
PSLSQKSSPF AWENLDYLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29146228284squamosa promoter binding protein-like 4
Cis-element ? help Back to Top
SourceLink
PlantRegMap678292470
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083361.10.0squamosa promoter-binding-like protein 14
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128871219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.11e-177squamosa promoter binding protein-like 14