PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678291937
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MIKC_MADS
Protein Properties Length: 234aa    MW: 26850.8 Da    PI: 9.9203
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678291937genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.66.6e-28959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krie+++nrqvtfskRr+g++KK +ELSvLCda++ +i+fss+gkl ey +
  678291937  9 KRIESTTNRQVTFSKRRAGLMKKTHELSVLCDAQIGLIVFSSKGKLTEYTT 59
               79***********************************************75 PP

2K-box42.33.3e-15901651289
      K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                  +e+++qelak+kke+ nL+ ++ +++G dL s +++eL+++eqqL++s+ k+Rs+K  l+ +q++++ + e ++++
  678291937  90 VAQERMHQELAKMKKETLNLELSLQRYKGYDLCSVQFEELNRIEQQLQHSVLKVRSRK--LMSNQLQNQAEVESQQHQ 165
                45799****************************************************8..899999999988888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.188161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-38160IPR002100Transcription factor, MADS-box
CDDcd002652.56E-41278No hitNo description
SuperFamilySSF554553.27E-31283IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-28323IPR002100Transcription factor, MADS-box
PfamPF003197.0E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.6E-1191165IPR002487Transcription factor, K-box
PROSITE profilePS5129710.61392190IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGRGKIEVKR IESTTNRQVT FSKRRAGLMK KTHELSVLCD AQIGLIVFSS KGKLTEYTTP  60
PLSMKEIIDK YYKTRGLHFP DNNTAAGSAV AQERMHQELA KMKKETLNLE LSLQRYKGYD  120
LCSVQFEELN RIEQQLQHSV LKVRSRKLMS NQLQNQAEVE SQQHQGMTAV KLLDHQQEPL  180
LNQFLFSRED LQLGTLPLHP HSSHLQQTHP NLQGFGLGIR MPDFIPLSDN SKWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A2e-18185183MEF2 CHIMERA
6bz1_B2e-18185183MEF2 CHIMERA
6bz1_C2e-18185183MEF2 CHIMERA
6bz1_D2e-18185183MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678291937
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012843283.11e-83PREDICTED: MADS-box protein defh21
SwissprotQ8RVL43e-77DEF21_ANTMA; MADS-box protein defh21
TrEMBLA0A2G9GAS31e-93A0A2G9GAS3_9LAMI; MADS box transcription factor
STRINGMigut.C01064.1.p4e-83(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.22e-52MIKC_MADS family protein