PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_33995-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 381aa    MW: 41413.9 Da    PI: 5.7289
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_33995-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.89.7e-13298345552
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                      +r  r++kNRe+A+ sR  K+a+++eLe +   L++eN+ Lk e +++
  TRIUR3_33995-P1 298 RRHHRMIKNRESATQSRGWKQAYTKELEAELNHLKEENSHLKAEEKTI 345
                      5789**************************************987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-9293359IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.427296341IPR004827Basic-leucine zipper domain
PfamPF001702.4E-10298345IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.6E-11298345No hitNo description
SuperFamilySSF579596.88E-9298344No hitNo description
CDDcd147072.07E-18298352No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010152Biological Processpollen maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MASEMSKDVN FSEEEVTSHP RVPEGEEQTV APARQSSIFA PTLDELQYSM CEARRNFGSM  60
NMDEFMSNIW NAKEFQAATG GVLVGMEVAP VVGVDGGRGG EDAGGSNLAR QESFSLPPPL  120
CRKMVEEVWA EINRETRPVH SQPQSARPSP LIPVEPPARN GGGVAANEQW GALGEMTLEQ  180
FLVKVGVVRG SGTGGQAPVA VGMVHGQMNP TPANDMFQVM GDGMVFIPNG YAGMVVVPPP  240
PPPQGGVGIV SPGSPYGRST MTEVDMMNCM GDRAMMENSG ARKRGTPEDQ SCERSIERRH  300
HRMIKNRESA TQSRGWKQAY TKELEAELNH LKEENSHLKA EEKTILLTKK QMLVEKVMEQ  360
SKENVNTKKG GALSRRCGSC I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2389321e-175AB238932.1 Triticum aestivum TaABI5 mRNA for bZip type transcription factor TaABI5, complete cds.
GenBankAF5198031e-175AF519803.1 Triticum aestivum ABA response element binding factor (ABFA) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628684.11e-130PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_015628691.11e-130PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLM7ZIE90.0M7ZIE9_TRIUA; Protein ABSCISIC ACID-INSENSITIVE 5
STRINGMLOC_34679.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.12e-26ABA-responsive element binding protein 3